DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and dma-1

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:414 Identity:103/414 - (24%)
Similarity:157/414 - (37%) Gaps:93/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RTLIFENCTF--TNFPLRLFYTLEVSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPT 158
            |.|...||..  .:..:|| .:|||  ||:....|......||. |..||.:|.||.||:.:|||
 Worm    92 RVLRLINCQIPAMSRSIRL-PSLEV--LDLHSNNIEHATMSNFG-GMPKLRVLDLSSNHLNILPT 152

  Fly   159 KTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTEN-----RLEALAADV---------F 209
            ..|.....|..:.|:.|.:..|.......|..|:.|.|..|     .:..|..||         .
 Worm   153 GVFTYLRALRSLSLSNNTISDLSTNLLRGLNSLRVLRLDRNPIPIEHINELFTDVSQLDELYLNH 217

  Fly   210 AGLKS-----------LRHVGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRH 263
            ..|.|           ||.:|:.||.|..:.:......|.|..:.:.:|.::|:...||.:.   
 Worm   218 CNLSSIYSLALDRIPQLRQLGIGGNNLKMVPTKELRSLPQLSVLDLSHNSIQEITACAFCNT--- 279

  Fly   264 HQMQYVDLSNNPELVVLLLNINATN-----------LTARNCSLDRVNLYGS---------VTNV 308
             .:..:|||:|      ||.|:..:           |...:.|.:.:|.:.|         :|::
 Worm   280 -NISKLDLSHN------LLGISKDSPFNEDAFRTMPLRHLDLSFNHMNDFDSKWLGWAQEELTSI 337

  Fly   309 DLSDNRVR---ELYFPASEALEHLVLRNNSL----VQLASLSRVPRLRHLDVADNPNLGQLPDGW 366
            .||.|.::   |.:....::|.||.|..|.:    |||.  ||...|..|:::.| .|..|||..
 Worm   338 ALSGNFLKNFEESWTYTLKSLIHLELAYNHIKFIPVQLP--SRYYHLISLNISGN-ELTYLPDNI 399

  Fly   367 RTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNC 431
            .|              .||        |::..||:.|.......:....|..:...|:.||.|:|
 Worm   400 NT--------------LLP--------NVKTFDITANRFHTFSHTDLAFLNNVEQVYVDGNPWDC 442

  Fly   432 FSLRNIMDVLIRANGIAYTVDNYD 455
            ......:.|.:|.......:.|||
 Worm   443 SCAIQGLQVHMRDRYAMRHILNYD 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 7/23 (30%)
LRR_RI 143..407 CDD:238064 76/315 (24%)
leucine-rich repeat 143..166 CDD:275380 10/22 (45%)
LRR_8 166..225 CDD:290566 19/83 (23%)
leucine-rich repeat 167..190 CDD:275380 5/22 (23%)
leucine-rich repeat 191..214 CDD:275380 8/36 (22%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..265 CDD:275380 5/25 (20%)
leucine-rich repeat 266..325 CDD:275380 16/81 (20%)
LRR_8 304..357 CDD:290566 18/68 (26%)
leucine-rich repeat 326..347 CDD:275380 10/24 (42%)
leucine-rich repeat 348..394 CDD:275380 10/45 (22%)
LRR_8 369..428 CDD:290566 9/58 (16%)
LRR_4 393..433 CDD:289563 10/39 (26%)
leucine-rich repeat 395..418 CDD:275380 4/22 (18%)
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 21/58 (36%)
leucine-rich repeat 91..112 CDD:275380 6/20 (30%)
leucine-rich repeat 113..136 CDD:275380 9/25 (36%)
LRR 136..430 CDD:227223 78/328 (24%)
leucine-rich repeat 137..160 CDD:275380 10/22 (45%)
leucine-rich repeat 161..184 CDD:275380 5/22 (23%)
leucine-rich repeat 185..209 CDD:275380 7/23 (30%)
leucine-rich repeat 210..233 CDD:275380 2/22 (9%)
leucine-rich repeat 234..257 CDD:275380 6/22 (27%)
leucine-rich repeat 258..280 CDD:275380 5/25 (20%)
leucine-rich repeat 281..307 CDD:275380 7/31 (23%)
leucine-rich repeat 309..357 CDD:275380 9/47 (19%)
leucine-rich repeat 382..405 CDD:275380 10/45 (22%)
leucine-rich repeat 406..429 CDD:275380 4/22 (18%)
TPKR_C2 438..>478 CDD:387596 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.