DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and lron-5

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_497943.2 Gene:lron-5 / 184307 WormBaseID:WBGene00008656 Length:656 Species:Caenorhabditis elegans


Alignment Length:498 Identity:122/498 - (24%)
Similarity:180/498 - (36%) Gaps:149/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PLRLFY-TLEVSELDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFL 172
            |..||: .|.|  |.|..||:..|....| :....|.::.||:||:|.||....|....|..:.|
 Worm    65 PHFLFHPNLRV--LRMSRCGMHEIPGSTF-LPLPGLEVIDLSNNHLETLPPTVLRSLKFLRVLIL 126

  Fly   173 NRNKLGKLQAGAFDNL-------LKLQYLDLTENRLE-ALAADVFAGLKSLRHVGLAGNQLTTI- 228
            :.|:|..|     |.|       :.|:.|||:.|.:. |.:..||   ..:|.:.|:..::.:: 
 Worm   127 SNNRLSNL-----DQLTWILAPGVVLEQLDLSGNPIAIATSMTVF---PPVRQLFLSDTRMESVN 183

  Fly   229 -------------ESDLFAHNP-------DLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSN 273
                         :.|:..|.|       .:.::...:||..|:...|.   .......||||||
 Worm   184 ETAIMFKKLPGKCDRDVCRHIPIHNLNVSIITTIDFSSNRDLEIDSGAL---DVFSNATYVDLSN 245

  Fly   274 NPELV-----------VLLLNINATNL-----TARNC-----SLD---------RVNLYGSVTNV 308
            ....|           |..|||:...|     |...|     |||         |.:.:..:.:|
 Worm   246 TRLPVGFEEWLERKSRVKSLNISHCQLPLHEDTWTACGQFLHSLDISGIGAKRLRFSRFCPIRSV 310

  Fly   309 DLSDNRVRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEM 373
            ...||.:..:|..| .::|.|.|..|...:..    :|                |.|.....|..
 Worm   311 FARDNLISSVYIDA-VSMESLHLERNMFSEFP----IP----------------PPGVELTELHT 354

  Fly   374 LVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPT--------------LTQLTHFYI 424
            |.|.:.....||..|||...|||..|:|.|.|:||||.|||:              |:.|.|   
 Worm   355 LGLSHNLMTSLPPHALQSYPNLQHFDVSSNQLSEIDPQAFPSIGLGLISLDLSSNQLSSLPH--- 416

  Fly   425 HGNNWNCFSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACMYRLPEKEGVDSSSSSEISAS 489
                       .|:..|:..:....|:.:.||.|    |.|:..:.:|                .
 Worm   417 -----------PILPSLLLLDLSFNTISHLDPHF----FTGLPMLQQL----------------R 450

  Fly   490 VESSPITSSSDPSE-----VDKLRDELKAVVQHFDSKFDLIFS 527
            :.|:|...|..|:.     .|.| |||.::|....|...|.||
 Worm   451 IASNPTLFSRCPNRDSPCWSDHL-DELTSLVDLDISNSGLEFS 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 7/23 (30%)
LRR_RI 143..407 CDD:238064 78/322 (24%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
LRR_8 166..225 CDD:290566 17/66 (26%)
leucine-rich repeat 167..190 CDD:275380 7/29 (24%)
leucine-rich repeat 191..214 CDD:275380 8/23 (35%)
leucine-rich repeat 215..238 CDD:275380 5/43 (12%)
leucine-rich repeat 239..265 CDD:275380 4/25 (16%)
leucine-rich repeat 266..325 CDD:275380 23/88 (26%)
LRR_8 304..357 CDD:290566 10/52 (19%)
leucine-rich repeat 326..347 CDD:275380 4/20 (20%)
leucine-rich repeat 348..394 CDD:275380 10/45 (22%)
LRR_8 369..428 CDD:290566 25/72 (35%)
LRR_4 393..433 CDD:289563 17/53 (32%)
leucine-rich repeat 395..418 CDD:275380 14/36 (39%)
lron-5NP_497943.2 leucine-rich repeat 51..72 CDD:275380 3/6 (50%)
LRR_8 72..131 CDD:338972 20/61 (33%)
leucine-rich repeat 73..96 CDD:275380 8/25 (32%)
LRR <92..>272 CDD:227223 44/190 (23%)
leucine-rich repeat 97..120 CDD:275380 9/22 (41%)
leucine-rich repeat 121..146 CDD:275380 7/29 (24%)
leucine-rich repeat 147..168 CDD:275380 8/23 (35%)
leucine-rich repeat 169..208 CDD:275380 5/38 (13%)
leucine-rich repeat 209..237 CDD:275380 4/30 (13%)
leucine-rich repeat 238..284 CDD:275380 14/45 (31%)
leucine-rich repeat 327..351 CDD:275380 7/43 (16%)
internalin_A 345..>576 CDD:380193 49/183 (27%)
leucine-rich repeat 352..375 CDD:275380 8/22 (36%)
leucine-rich repeat 376..391 CDD:275380 8/14 (57%)
leucine-rich repeat 401..445 CDD:275380 11/61 (18%)
leucine-rich repeat 446..478 CDD:275380 10/48 (21%)
leucine-rich repeat 479..500 CDD:275380 5/14 (36%)
leucine-rich repeat 501..522 CDD:275380
leucine-rich repeat 523..544 CDD:275380
LRRCT 553..601 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.