DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and iglr-3

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:192 Identity:45/192 - (23%)
Similarity:78/192 - (40%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 PDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSL----- 296
            |::||:::.||.:..:  ..|.|..|..|...:|                      .|.|     
 Worm    49 PNVLSLSLSNNSIFRI--TTFPSEYRRLQSLRLD----------------------QCQLEKLDF 89

  Fly   297 DRVNLYGSVTNVDLSDNRVRELYFPASEA-LEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLG 360
            |.::::..:..:|:|.|.:.:|..|.:.| |..|.|..|:...:..:|.:..||.:|::.|..:.
 Worm    90 DALSVFEQLRELDVSRNSLSKLIIPRNLASLRVLNLAFNAFTYVPDMSHLESLRLVDLSHNRLIS 154

  Fly   361 QLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHF 422
            ..|   |.....:.|:|........|.....:..||:||::.|:| |.|.|       |.||
 Worm   155 VRP---RMLPFNLEVVRLAANRFQHLSPWPFLHKLQELDVTFNDL-ECDCS-------LWHF 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380
LRR_RI 143..407 CDD:238064 39/175 (22%)
leucine-rich repeat 143..166 CDD:275380
LRR_8 166..225 CDD:290566
leucine-rich repeat 167..190 CDD:275380
leucine-rich repeat 191..214 CDD:275380