DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cDIP and Gp5

DIOPT Version :9

Sequence 1:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_032174.2 Gene:Gp5 / 14729 MGIID:1096363 Length:567 Species:Mus musculus


Alignment Length:401 Identity:102/401 - (25%)
Similarity:151/401 - (37%) Gaps:116/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NFSIGADKLVILLLSDNHI---------EVLPTKTFRGAGN---------------LEFIFLNRN 175
            :|| |...|..|:|||:||         :::..||.|...|               ||.:||:.|
Mouse    69 SFS-GMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKISRLPRAILDKMVLLEQLFLDHN 132

  Fly   176 KLGKLQAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLR----------HV--GLAG------ 222
            .|..|....|..|..||.|.|.:|:|..|.|::|:.|:.|:          |:  ||.|      
Mouse   133 ALRDLDQNLFQQLRNLQELGLNQNQLSFLPANLFSSLRELKLLDLSRNNLTHLPKGLLGAQVKLE 197

  Fly   223 ------NQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNN-----PE 276
                  ||||:::|.|.::...|..:.::.|.||.|...||...|   .:..:.||.|     |.
Mouse   198 KLLLYSNQLTSVDSGLLSNLGALTELRLERNHLRSVAPGAFDRLG---NLSSLTLSGNLLESLPP 259

  Fly   277 LVVLLLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRVREL---YFPASEALEHLVLRNNSLVQ 338
              .|.|:::                  ||:.:.|.:|.:.||   .|.....|..|.|....|..
Mouse   260 --ALFLHVS------------------SVSRLTLFENPLEELPDVLFGEMAGLRELWLNGTHLST 304

  Fly   339 L--ASLSRVPRLRHLDVADNPNLGQLP-------------------------DGWR-TPHLEMLV 375
            |  |:...:..|:.|.:..||.|..||                         |..| ..||..:.
Mouse   305 LPAAAFRNLSGLQTLGLTRNPRLSALPRGVFQGLRELRVLALHTNALAELRDDALRGLGHLRQVS 369

  Fly   376 LRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLTHFYIHGNNWNCFS------- 433
            ||:.....||....:.:.:|:.:.:..|.|..:....|..|.|||...:..|.|.|..       
Mouse   370 LRHNRLRALPRTLFRNLSSLESVQLEHNQLETLPGDVFAALPQLTQVLLGHNPWLCDCGLWPFLQ 434

  Fly   434 -LRNIMDVLIR 443
             ||:..|:|.|
Mouse   435 WLRHHPDILGR 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 3/6 (50%)
LRR_RI 143..407 CDD:238064 86/347 (25%)
leucine-rich repeat 143..166 CDD:275380 10/31 (32%)
LRR_8 166..225 CDD:290566 26/97 (27%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
leucine-rich repeat 215..238 CDD:275380 11/46 (24%)
leucine-rich repeat 239..265 CDD:275380 8/25 (32%)
leucine-rich repeat 266..325 CDD:275380 13/66 (20%)
LRR_8 304..357 CDD:290566 15/57 (26%)
leucine-rich repeat 326..347 CDD:275380 6/22 (27%)
leucine-rich repeat 348..394 CDD:275380 15/71 (21%)
LRR_8 369..428 CDD:290566 14/58 (24%)
LRR_4 393..433 CDD:289563 11/39 (28%)
leucine-rich repeat 395..418 CDD:275380 5/22 (23%)
Gp5NP_032174.2 LRR 1 75..96 7/20 (35%)
LRR_8 76..134 CDD:290566 16/57 (28%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
LRR 2 99..120 4/20 (20%)
leucine-rich repeat 100..123 CDD:275380 4/22 (18%)
LRR 3 123..144 8/20 (40%)
LRR_8 124..182 CDD:290566 20/57 (35%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
LRR_RI 126..402 CDD:238064 73/298 (24%)
LRR 4 147..168 9/20 (45%)
leucine-rich repeat 148..171 CDD:275380 10/22 (45%)
LRR 5 171..193 5/21 (24%)
leucine-rich repeat 172..195 CDD:275380 5/22 (23%)
LRR_8 195..254 CDD:290566 17/61 (28%)
LRR 6 195..216 6/20 (30%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
LRR 7 219..240 7/20 (35%)
leucine-rich repeat 220..243 CDD:275380 8/25 (32%)
LRR_8 243..302 CDD:290566 16/78 (21%)
LRR 8 243..264 5/22 (23%)
leucine-rich repeat 244..267 CDD:275380 6/42 (14%)
LRR 9 267..288 7/20 (35%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR 10 291..312 6/20 (30%)
leucine-rich repeat 292..315 CDD:275380 6/22 (27%)
LRR_8 314..375 CDD:290566 13/60 (22%)
LRR 11 315..337 7/21 (33%)
leucine-rich repeat 316..338 CDD:275380 7/21 (33%)
LRR 12 340..361 1/20 (5%)
leucine-rich repeat 341..364 CDD:275380 2/22 (9%)
LRR_8 364..422 CDD:290566 14/57 (25%)
LRR 13 364..385 6/20 (30%)
leucine-rich repeat 365..388 CDD:275380 5/22 (23%)
LRR 14 388..409 4/20 (20%)
leucine-rich repeat 389..410 CDD:275380 4/20 (20%)
TPKR_C2 421..>454 CDD:301599 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.