DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and USP26

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_114113.1 Gene:USP26 / 83844 HGNCID:13485 Length:913 Species:Homo sapiens


Alignment Length:533 Identity:114/533 - (21%)
Similarity:214/533 - (40%) Gaps:123/533 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 DGLNATEDQELHF---RILQLESK-----AQDYIVENNRLREELSRIQELHNVTQQLSQKEVEAT 442
            :||::|:.::|..   |:.|.|.:     .:...|.::..::|::: ...|.|.::.|.|..|..
Human    84 EGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINK-TSFHKVDEKSSSKSFEIA 147

  Fly   443 RNIESKIRERQRL---------DEQHELERQERERLLAIARETKKHYKSPTPSGPPSPGRNLEDV 498
            :...:.:.:|..|         .|..|.:.::|:|:|:.:.|..:.:.....|......: .:..
Human   148 KGSGTGVLQRMPLLTSKLTLTCGELSENQHKKRKRMLSSSSEMNEEFLKENNSVEYKKSK-ADCS 211

  Fly   499 HVVSDSLESLLQLTG-------DPDPTIAPNKAEIPTFD-----RAMKPQPRNVERTSQRVRDFS 551
            ..||.:.|..|:|..       :.:.:...|....|..|     :|:         |.:.|..| 
Human   212 RCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQAL---------TEKMVLVF- 266

  Fly   552 PVIGQNVGRGLT------------------GLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYK- 597
             ::.|....|.|                  ||.|||||||||::||.|.:.|...:..::..:. 
Human   267 -LLQQGYSDGYTKWDKLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPW 330

  Fly   598 -----NYISRSNKTNGQVIEEVAALI--KELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHE 655
                 |.::..          :|.|:  |:.:|.:.|.:...:|:..:....:||.|..|.|:||
Human   331 GKIPLNALTMC----------LARLLFFKDTYNIEIKEMLLLNLKKAISAAAEIFHGNAQNDAHE 385

  Fly   656 FLTILMDWLHSDLQTLHV-------------PRQREMISASEKAWLEFTKAKESMILHLFYGQMK 707
            ||...:|.|..:::.|:.             |:|   :.|.:..    |......::..|..::.
Human   386 FLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQ---VFADDPD----TSGFSCPVITNFELELL 443

  Fly   708 STVKCVACHKESATYESFSNLSLELP------PNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKR 766
            .::.|.||.:.....|..:.||:.||      |:|    :....|::|..|.:. :.|..|:.| 
Human   444 HSIACKACGQVILKTELNNYLSINLPQRIKAHPSS----IQSTFDLFFGAEELE-YKCAKCEHK- 502

  Fly   767 DAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQN-------YLRFPLE-NLDMNPYIARAES 823
            .::.....|:||.:|:|||||:   ..|....:||.:       ||:.... |....|.:..:|.
Human   503 TSVGVHSFSRLPRILIVHLKRY---SLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLPLSED 564

  Fly   824 RAVTPKTYQLYAV 836
            ..:|  .:||..|
Human   565 GEIT--DFQLLKV 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 77/328 (23%)
Peptidase_C19R 564..887 CDD:239139 76/308 (25%)
USP26NP_114113.1 UCH_N 3..103 CDD:293279 5/18 (28%)
UCH 296..>559 CDD:278850 71/288 (25%)
Peptidase_C19 296..>558 CDD:239072 70/287 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 753..772
Peptidase_C19 <802..884 CDD:239072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.