DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and UBP21

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_568667.1 Gene:UBP21 / 834717 AraportID:AT5G46740 Length:732 Species:Arabidopsis thaliana


Alignment Length:532 Identity:141/532 - (26%)
Similarity:220/532 - (41%) Gaps:139/532 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 IVENNRLREELSRIQELHN-VTQQLSQKEVEATRNIESKIRERQRL-------------DEQHEL 461
            :.:.|:..:|.|....:.: ||..||         :.|.||:.|.|             |:....
plant    18 LTKPNQTLDESSPTAPIRDLVTNSLS---------LSSPIRQIQALSPAKPDGSSSSPPDKTLNF 73

  Fly   462 ERQERERLLAIARETKKHYKSPTPS-----GPP---SPGRNLEDVHVVSDSLESL-------LQL 511
            ..:|.       |:......|.:||     .||   ||..|...:.:.:.|...|       ::.
plant    74 NPEEN-------RDVNPDESSSSPSDKTLIAPPAQISPVSNNNHLRITNTSDSYLYRPPRRYIEY 131

  Fly   512 TGDPDPTIAPNKAEIPTFDRAMKP------QPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGN 570
            ..|.|..   ||.| ||     ||      .|| :|.|             .||   .||.|.||
plant   132 ESDDDEL---NKME-PT-----KPLQLSWWYPR-IEPT-------------GVG---AGLYNSGN 170

  Fly   571 TCYMNSILQCLSNTPQLTE-----------------YCISDKYKNYISRSNKTNGQVIEEVAALI 618
            ||::.|:|||.::|..|.:                 :|:....:::|..:.:::|..|.     |
plant   171 TCFIASVLQCFTHTVPLIDSLRSFMYGNPCNCGNEKFCVMQALRDHIELALRSSGYGIN-----I 230

  Fly   619 KELWNGQYKCVASRD-LRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISA 682
            ...          || |.|    :...|....|:|:||||...:|.|  :...|....|...:|:
plant   231 DRF----------RDNLTY----FSSDFMINHQEDAHEFLQSFLDKL--ERCCLDPKNQLGSVSS 279

  Fly   683 SEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDM 747
            .:.          :::.::|.|.:.||:.|..|:..|.|:|.....|||:   .:|..|.:.::.
plant   280 QDL----------NIVDNVFGGGLMSTLCCCNCNSVSNTFEPSLGWSLEI---EDVNTLWKALES 331

  Fly   748 YFSGERIHG-WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKK-QNYLRFPLE 810
            :...|::.. ..|.:||.|....|:|...|||||...|||||    :|.|..|:| .:::.||||
plant   332 FTCVEKLEDQLTCDNCKEKVTKEKQLRFDKLPPVATFHLKRF----TNDGVTMEKIFDHIEFPLE 392

  Fly   811 NLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEG-GHYTAFCKSANYGKWFKFDDQVVSALDSS 874
             ||::|:::......|:.: |.|||...|.|.... |||:::.:||. ..|..|||..|:.:...
plant   393 -LDLSPFMSSNHDPEVSTR-YHLYAFVEHIGIRATFGHYSSYVRSAP-ETWHNFDDSKVTRISEE 454

  Fly   875 NVVSSAAYILFY 886
            .|:|..||||||
plant   455 RVLSRPAYILFY 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 99/344 (29%)
Peptidase_C19R 564..887 CDD:239139 101/344 (29%)
UBP21NP_568667.1 Peptidase_C19E 162..467 CDD:239126 102/349 (29%)
UCH 163..466 CDD:278850 99/343 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.