DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and UBP20

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_567544.1 Gene:UBP20 / 827513 AraportID:AT4G17895 Length:695 Species:Arabidopsis thaliana


Alignment Length:512 Identity:135/512 - (26%)
Similarity:218/512 - (42%) Gaps:110/512 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 LHNVTQQLSQKE-VEA-TRNIESKIRERQRLDEQHELERQERERLLAIARETKKHYKSPT---PS 486
            |.|..:.|.:.| :|| ..|::|........|...:.:.......::|.......|.|.:   ..
plant    20 LPNSIETLDENESIEAQVNNVQSLALSSPNRDRSDDDDNNNNHDSVSIPPPIYDGYSSSSSDESQ 84

  Fly   487 GPPSPGRNLE--------DVHVVSDSLESL-LQLTGDPD---------PTIAP---NKAEIPTFD 530
            ..|||..||:        .:...|.:|:.: ..:.||.|         |.::|   :..:....|
plant    85 SVPSPPINLDHDDDECQIPIRNTSQALDDIDDDIWGDDDLPETRRPWTPNVSPGFGSDDDDDNDD 149

  Fly   531 RAMKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDK 595
            ...|.:||.......| ::..||.|  ||   .||.||||:|::||:.||.::|..|.|..:|.:
plant   150 DNSKNEPRKSLFYGFR-QEPEPVTG--VG---AGLWNLGNSCFLNSVFQCFTHTVPLIESLLSFR 208

  Fly   596 YKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVV--------------------GQ 640
            |:......|                    ::.||. |.:||.:                    ..
plant   209 YEVPCHCGN--------------------EFFCVI-RAIRYHIEAALRPERCPIAPYFFFDNLNY 252

  Fly   641 YQKIFRGVDQQDSHEFLTILMDWLH---SDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLF 702
            :...|:...|:|:||||...::.|.   ||..:.     |..|::.:                :|
plant   253 FSPDFQRYQQEDAHEFLQAFLEKLEICGSDRTSF-----RGDITSQD----------------VF 296

  Fly   703 YGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERI-HGWNCPSCKTKR 766
            .|::.|.::|..|...|.|||....||||:   .:|..|...::.:...|:: ....|.:|..|.
plant   297 SGRLISGLRCCNCDYVSETYEKSVGLSLEI---EDVDTLGSALESFTRVEKLDEQLTCDNCNEKV 358

  Fly   767 DAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKK-QNYLRFPLENLDMNPYIARAESRAVTPKT 830
            ...|:|.:.|||.|...|||||    .|:|.||:| ..:::.||| :|:.||:...:...|:.| 
plant   359 SKEKQLLLDKLPLVATFHLKRF----KNNGLYMEKIYKHVKIPLE-IDLQPYMRNIQENEVSTK- 417

  Fly   831 YQLYAVSNHYG-TMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886
            |.|||:..|:| ::..|||:::.:||. ..|..|||..|:.:|...|:|..:|||||
plant   418 YHLYALVEHFGYSVAYGHYSSYVRSAP-KIWHHFDDSKVTRIDEDMVLSQDSYILFY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 99/349 (28%)
Peptidase_C19R 564..887 CDD:239139 101/349 (29%)
UBP20NP_567544.1 Peptidase_C19E 175..474 CDD:239126 102/354 (29%)
UCH 176..473 CDD:278850 99/348 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.