DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and UBP19

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_565576.1 Gene:UBP19 / 817000 AraportID:AT2G24640 Length:672 Species:Arabidopsis thaliana


Alignment Length:360 Identity:91/360 - (25%)
Similarity:154/360 - (42%) Gaps:84/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 GLKNLGNTCYMNSILQCLSNTPQLTEY---------------CISDKYKNYISRSNKTN-----G 608
            ||.|.||:|:.|.:|||||.|..|..|               |...:::|::.|:|.:.     .
plant   175 GLTNCGNSCFANVVLQCLSWTRPLVAYLLERGHKRECRRNDWCFLCEFENHLDRANYSRFPFSPM 239

  Fly   609 QVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDL----- 668
            .:|..:..:...|..|:                        |:|:||.:...:|.:.|..     
plant   240 NIISRLPNIGGNLGYGR------------------------QEDAHELMRFAIDMMQSVCLDEFG 280

  Fly   669 -QTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLEL 732
             :.:..||.:|                .::|.::|.|.::|.|:|.||...|..||:..:|::|:
plant   281 GEKVVPPRAQE----------------TTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEI 329

  Fly   733 PPNSNVCQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSN 794
              :.:...|.:|:|.:.:.|.:.|   :.|..|.....|.|:|.|...|.:|.:.||||     .
plant   330 --HGDAVSLEECLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRF-----Q 387

  Fly   795 SGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEG---GHYTAFCKSAN 856
            .|.:.|....:.|| |..|:.||::.....:   ..|:||||..|...:..   |||..:.|...
plant   388 GGRFGKLNKRISFP-ETFDLGPYMSGGGEGS---DVYKLYAVIVHLDMLNASFFGHYICYVKDFR 448

  Fly   857 YGKWFKFDDQVVSALDSSNVVSSAAYILFYTWLPP 891
             |.|::.||..|..::..:|:|..||:|.|:.:.|
plant   449 -GNWYRIDDSEVEKVELEDVLSQRAYMLLYSRVQP 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 89/353 (25%)
Peptidase_C19R 564..887 CDD:239139 89/354 (25%)
UBP19NP_565576.1 zf-MYND 64..101 CDD:280009
Peptidase_C19E 173..478 CDD:239126 89/354 (25%)
UCH 173..477 CDD:278850 89/353 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.