DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp50

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_083439.2 Gene:Usp50 / 75083 MGIID:1922333 Length:390 Species:Mus musculus


Alignment Length:343 Identity:122/343 - (35%)
Similarity:185/343 - (53%) Gaps:23/343 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 RGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWNG 624
            :|:|||:|||||||||:|||||.:...|.||.:|.|   ||:...|...:|....|.|:.::|.|
Mouse    42 QGVTGLRNLGNTCYMNAILQCLCSVSPLVEYFLSGK---YITALKKDCSEVTTAFAYLMTDMWLG 103

  Fly   625 QYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLE 689
            ...||:.......||.....|....|||:.|||..:::.||..|:. |..|:.......:....:
Mouse   104 DSDCVSPEIFLSAVGSLYPAFLKKTQQDAQEFLIYVLNELHEALKK-HCRRRVNEKRTGQSCCRK 167

  Fly   690 FTKAKESMILHLFYGQMKSTVKCVACHKESATY--ESFSNLSLELPPNSNVCQLNQCMDMYFSGE 752
            ....:.|:|..||.||:..::.|:.|  ||.|:  |.|:.|||.:|.:.. |.|..|:..:|..:
Mouse   168 VPAQETSIITRLFEGQLSYSITCLKC--ESCTHKNEVFTILSLPIPSDYE-CSLQDCLQCFFQQD 229

  Fly   753 RIHGWN----CPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKK-QNYLRFPLENL 812
            .: .|:    |..|:.|::|..:..|||:|.::|.|.|||    ...|:..:| :..:.:||.||
Mouse   230 TL-TWSNQIYCSFCEIKQEAAVRTTISKVPKIIVFHFKRF----DIQGTVKRKLRTDIHYPLTNL 289

  Fly   813 DMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVV 877
            |:.|||.....:   ...|.|.||.||:|.::|||||||||::....|:.|||..||.:..::|.
Mouse   290 DLTPYICPVFRK---HPMYNLCAVVNHFGDLDGGHYTAFCKNSVTQAWYSFDDTRVSEIPDTSVQ 351

  Fly   878 SSAAYILFYTWLPPMQVP 895
            ::.||:|||: ..|..:|
Mouse   352 TATAYLLFYS-CQPFSIP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 117/330 (35%)
Peptidase_C19R 564..887 CDD:239139 117/329 (36%)
Usp50NP_083439.2 UCH 44..360 CDD:278850 117/330 (35%)
Peptidase_C19R 46..361 CDD:239139 117/329 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469048at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.