DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and LOC689730

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:XP_038952348.1 Gene:LOC689730 / 689730 RGDID:1588758 Length:541 Species:Rattus norvegicus


Alignment Length:394 Identity:109/394 - (27%)
Similarity:180/394 - (45%) Gaps:82/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 DPTIAPNKAEIPTFDRAMKPQPRNVERTSQRVRDFSPVIG-QNVGRGLTGLKNLGNTCYMNSILQ 579
            ||.::|     |......:.:.|.:|..|.:.:   |.:. |.:....:||:|:||:||:|::||
  Rat    10 DPAMSP-----PATPELHQDEARVLEELSAKGK---PSLSLQRIQSPGSGLQNIGNSCYLNAVLQ 66

  Fly   580 CLSNTPQLTEYCISDKYKN---------------YISRS--NKTNGQVIEEVAALIKELWNGQYK 627
            ||::||.|.:|.:|.::..               ::::|  :..:|.|::....|          
  Rat    67 CLTHTPPLADYMLSQEHSQRCCYPEGCKMCAMEAHVTQSLLHSHSGGVMKPSEIL---------- 121

  Fly   628 CVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTK 692
                          ...|....|:|:||||...::.:|.  ..|...:|.|            |.
  Rat   122 --------------TSTFHKHRQEDAHEFLMFTLNAMHE--SCLRGCKQSE------------TS 158

  Fly   693 AKESMILH-LFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHG 756
            :|:|.::: :|.|||:|.:||..|.....:|:.|.||.|::....:|   .|.::.....|.:.|
  Rat   159 SKDSSLIYDIFGGQMRSQIKCHHCQGTLDSYDPFLNLFLDICSAQSV---KQALEDLVKLEELQG 220

  Fly   757 WN---CPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQNYLRFPLENLDMNPYI 818
            .|   |..|:.|..|.|...:.....||::.|.|.|....:     |....:.:| |.||:.||:
  Rat   221 DNAYYCGRCREKMPASKTTKVQTASKVLLLVLNRSYDFGGD-----KLNRVVSYP-EYLDLQPYL 279

  Fly   819 ARAESRAVTPKTYQLYAVSNHYG-TMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAY 882
            ::.   ...|..|.||||..|.| |...|||..:.| |::|||:|.||..|:..|.|:|:|..||
  Rat   280 SQP---TAGPLPYALYAVLVHDGVTCSSGHYFCYVK-ASHGKWYKMDDSKVTRCDVSSVLSEPAY 340

  Fly   883 ILFY 886
            :|||
  Rat   341 LLFY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 98/345 (28%)
Peptidase_C19R 564..887 CDD:239139 100/345 (29%)
LOC689730XP_038952348.1 Peptidase_C19E 49..345 CDD:239126 100/347 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.