DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and usp3

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001186800.1 Gene:usp3 / 569679 ZFINID:ZDB-GENE-030131-5142 Length:524 Species:Danio rerio


Alignment Length:399 Identity:128/399 - (32%)
Similarity:188/399 - (47%) Gaps:66/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 NVERTSQR--VRDFSP--VIGQNVGRGL----TGLKNLGNTCYMNSILQCLSNTPQLTEYCISDK 595
            |.:|..:|  ...|||  .:.|:....|    |||:||||||:||:|||.|||....:  |...:
Zfish   131 NTDRQRKRKMSESFSPDSKMKQDSEGALVQCATGLRNLGNTCFMNAILQSLSNIQVFS--CYFKE 193

  Fly   596 YKNYISRSNKTNGQ--------------VIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFR 646
            ..:...||.||.|:              ::||....:..||.|.....:...|.||:.:....||
Zfish   194 LPSVALRSGKTAGRRMYHTRSQGDSSVSLVEEFRKTLCSLWQGSQTAFSPDALFYVIWKIMPSFR 258

  Fly   647 GVDQQDSHEFLTILMDWLHSDLQ-----------TLHVPRQREMISASEKAWLEFTKAKESMILH 700
            |..|||:||||..|:|.||.::|           |...|..     |||...  |.....:::..
Zfish   259 GYQQQDAHEFLRYLLDHLHREMQGNKNGSPSPPVTSDEPNH-----ASESKC--FINGTSTIVTS 316

  Fly   701 LFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNV-----------CQLNQCMDMYFSGERI 754
            :|.|.:::.|.|:.|..||..::.|.:|||::|....:           |.|:.|:..:...|.:
Zfish   317 VFGGVLQNEVYCLICGTESRKFDPFLDLSLDIPNQFRIKTTKDQEPGPTCTLSDCLRSFTDLEEL 381

  Fly   755 HG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFY--ADPSNSGSYMKKQNYLRFPLENLDM 814
            ..   :.|..||.::.:.||..|.|||.||.:|||||:  |...|     |...|:.||:..|||
Zfish   382 DETELYMCHKCKKRQKSTKKFWIQKLPKVLCLHLKRFHWTAFLRN-----KVDTYVEFPMCGLDM 441

  Fly   815 NPYIARAESRAVTPKTYQLYAVSNHYGTMEG-GHYTAFCKSANYGKWFKFDDQVVSALDSSNVVS 878
            ..|:...|:.......|.|.||..|:|:..| |||||:  ..:.|:|:.|:|..|:.:....|:.
Zfish   442 KSYLLEPENSLPERCLYDLAAVVVHHGSGIGSGHYTAY--GRHEGQWYHFNDSTVTLVSEEAVLK 504

  Fly   879 SAAYILFYT 887
            :.|||||||
Zfish   505 AKAYILFYT 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 118/369 (32%)
Peptidase_C19R 564..887 CDD:239139 117/364 (32%)
usp3NP_001186800.1 zf-UBP 29..109 CDD:280334
UCH 162..512 CDD:278850 117/365 (32%)
Peptidase_C19 164..513 CDD:271592 117/364 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469048at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.