DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp27x

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_062334.2 Gene:Usp27x / 54651 MGIID:1859645 Length:438 Species:Mus musculus


Alignment Length:397 Identity:118/397 - (29%)
Similarity:192/397 - (48%) Gaps:63/397 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 PTFDRAMKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYC 591
            ||:: ..||:...:....:|.|     |..:...||.||.||||||:||.|:|.|::||.|.::.
Mouse    48 PTWE-TTKPELELLGHNPRRRR-----IASSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFF 106

  Fly   592 ISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEF 656
            :||:::..:......   ::.|:::|.:||::|.........|.::|..:.:...|..|||:|||
Mouse   107 LSDRHRCEMPSPELC---LVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEF 168

  Fly   657 LTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESAT 721
            |...:|.||...:...|.:    ::::....       ..:|..:|.|.::|.|.|.|||..|.|
Mouse   169 LIAALDVLHRHCKGDDVGK----VASNPNHC-------NCIIDQIFTGGLQSDVTCQACHGVSTT 222

  Fly   722 YESFSNLSLELP-------PNS--------------NVCQLNQCMDMYFSGERIHG---WNCPSC 762
            .:...::||:||       |.|              .:..|..|:..:...|.:..   ..|.||
Mouse   223 IDPCWDISLDLPGSCTSFWPMSPGRESSLNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSC 287

  Fly   763 KTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKK-QNYLRFPLENLDMNPYIARAESRAV 826
            ::.:::.|:|.:.|||.|...|.|||    .:|....:| ..|:.|||| |||.|::|.::...|
Mouse   288 QSYQESTKQLTMKKLPVVACFHFKRF----EHSAKQRRKITTYISFPLE-LDMTPFMASSKETRV 347

  Fly   827 ------------TPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSS 879
                        ....|.|:||.||.||:|.||||:|.:. :..:|||.||.|::.....:|:.|
Mouse   348 NGQLQLPTNSANNENKYSLFAVVNHQGTLESGHYTSFIRH-HRDQWFKCDDAVITKASIKDVLDS 411

  Fly   880 AAYILFY 886
            ..|:|||
Mouse   412 EGYLLFY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 108/360 (30%)
Peptidase_C19R 564..887 CDD:239139 109/360 (30%)
Usp27xNP_062334.2 UCH 77..418 CDD:278850 108/360 (30%)
Peptidase_C19D 78..419 CDD:239125 109/361 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.