DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp32

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster


Alignment Length:249 Identity:85/249 - (34%)
Similarity:123/249 - (49%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNK--TNGQVIEEVAALIKELWN 623
            |.|||.||||||:||:.||.|.||..|.:|...:.::..::.:||  |.||:....|.|:||:|.
  Fly   739 GATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKGQLAMRYAELLKEVWT 803

  Fly   624 GQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDL-QTLHVP---------RQRE 678
            ...:.||...||:.|.:|...|.|..|.||.|.|..|:|.||.|| :.:..|         |..:
  Fly   804 ATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELKDSNGRPDK 868

  Fly   679 MISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQ 743
            :::|  :||.:.....:|:|:.|||||:||.|.|:.|..||..::.||.|||.||..:.:     
  Fly   869 IVAA--EAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYI----- 926

  Fly   744 CMDMYFS--------------GERIHGWNCPSCKTKRDAIKKLDISKLPPVLVV 783
                ||.              |.|::.    .||......|...:..|||.|::
  Fly   927 ----YFEVLVILLDGSVPIKYGFRLNS----DCKYSHLKHKLSTMCSLPPNLML 972

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 84/248 (34%)
Peptidase_C19R 564..887 CDD:239139 83/246 (34%)
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 85/249 (34%)
Peptidase_C19 <1480..1737 CDD:351799
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.