DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and not

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster


Alignment Length:347 Identity:106/347 - (30%)
Similarity:177/347 - (51%) Gaps:35/347 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQ 625
            ||.||.|||.||:||.|:|.|.:||.|::|.:||::......|:|.   ::.||:.|.:|.::|.
  Fly   156 GLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRHDCGSKSSHKC---LVCEVSRLFQEFYSGS 217

  Fly   626 YKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEF 690
            ...::...|.:::..:.|...|.:|||:|||....:|.||..........:.:..|:...:....
  Fly   218 RSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNS 282

  Fly   691 TKAKES--------MILHLFYGQMKSTVKCVACHKESATYESFSNLSLEL---------PPNSNV 738
            :.:..|        :|..:|.|.::|.|.|.||:..|.||:.|.::||:|         .|.:  
  Fly   283 SNSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKT-- 345

  Fly   739 CQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMK 800
              |..|::.|...|.:..   ..|.:||:.:::.|:..:..||.|:..|||||    .:|....:
  Fly   346 --LIDCLERYTRAEHLGSAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRF----EHSALIDR 404

  Fly   801 K-QNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFD 864
            | .::::||:| .||.|:::. :..|.....:.||||.||.||::.|||||:.:... ..|.|.|
  Fly   405 KISSFIQFPVE-FDMTPFMSE-KKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQK-DTWVKCD 466

  Fly   865 DQVVSALDSSNVVSSAAYILFY 886
            |.|::......|:.|..|:|||
  Fly   467 DHVITMASLKQVLDSEGYLLFY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 103/344 (30%)
Peptidase_C19R 564..887 CDD:239139 104/344 (30%)
notNP_001287106.1 zf-UBP 46..103 CDD:307999
Peptidase_C19D 158..489 CDD:239125 104/345 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.