DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and USP27X

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens


Alignment Length:405 Identity:122/405 - (30%)
Similarity:193/405 - (47%) Gaps:75/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 EIPTFDRAMKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTE 589
            :.||:: ..||:...:....:|.|     |..:...||.||.||||||:||.|:|.|::||.|.:
Human    46 KFPTWE-TTKPELELLGHNPRRRR-----ITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRD 104

  Fly   590 YCISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSH 654
            :.:||:::..:......   ::.|:::|.:||::|.........|.::|..:.:...|..|||:|
Human   105 FFLSDRHRCEMPSPELC---LVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAH 166

  Fly   655 EFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKES------MILHLFYGQMKSTVKCV 713
            |||...:|.||...:...|                 .||..:      :|..:|.|.::|.|.|.
Human   167 EFLIAALDVLHRHCKGDDV-----------------GKAANNPNHCNCIIDQIFTGGLQSDVTCQ 214

  Fly   714 ACHKESATYESFSNLSLELP-------PNS--------------NVCQLNQCMDMYFSGERIHG- 756
            |||..|.|.:...::||:||       |.|              .:..|..|:..:...|.:.. 
Human   215 ACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSS 279

  Fly   757 --WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKK-QNYLRFPLENLDMNPYI 818
              ..|.||::.:::.|:|.::|||.|...|.|||    .:|....:| ..|:.|||| |||.|::
Human   280 AKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRF----EHSAKQRRKITTYISFPLE-LDMTPFM 339

  Fly   819 ARA-ESR-----------AVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSAL 871
            |.: |||           ......|.|:||.||.||:|.||||:|.:. :..:|||.||.|::..
Human   340 ASSKESRMNGQLQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRH-HKDQWFKCDDAVITKA 403

  Fly   872 DSSNVVSSAAYILFY 886
            ...:|:.|..|:|||
Human   404 SIKDVLDSEGYLLFY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 112/366 (31%)
Peptidase_C19R 564..887 CDD:239139 113/366 (31%)
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 113/367 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.