DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and USP17L2

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_958804.2 Gene:USP17L2 / 377630 HGNCID:34434 Length:530 Species:Homo sapiens


Alignment Length:439 Identity:115/439 - (26%)
Similarity:196/439 - (44%) Gaps:113/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 HYKSPTPSGPPSPGRNLEDVHVVSDSLESLLQLTGDPDPTIAPNKAEIPTFD------RAMKPQP 537
            |:...|.|.|              |:..:.:|.|..|:.:...::|.:...|      |.:.|: 
Human    16 HFSKLTSSRP--------------DAAFAEIQRTSLPEKSPLSSEARVDLCDDLAPVARQLAPR- 65

  Fly   538 RNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKN---- 598
            :.:..:|:|    ...:|       .||:|:|||||.|:.||||:.||.|..|.:|.::..    
Human    66 KKLPLSSRR----PAAVG-------AGLQNMGNTCYENASLQCLTYTPPLANYMLSREHSQTCQR 119

  Fly   599 -----------YISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQD 652
                       :|:.:..:.|.||:...||......|:                        |:|
Human   120 PKCCMLCTMQAHITWALHSPGHVIQPSQALAAGFHRGK------------------------QED 160

  Fly   653 SHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTK-----AKESMILH-LFYGQMKSTVK 711
            :||||...:|                   |.:||.|...|     :|::.::| :|.|..:|.:|
Human   161 AHEFLMFTVD-------------------AMKKACLPGHKQVDHHSKDTTLIHQIFGGCWRSQIK 206

  Fly   712 CVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLD 773
            |:.||..|.|::.:.:::|::....:|   .|.::.....|.::|   ::|..|..:..|.|.|.
Human   207 CLHCHGISDTFDPYLDIALDIQAAQSV---KQALEQLVKPEELNGENAYHCGLCLQRAPASKTLT 268

  Fly   774 ISKLPPVLVVHLKRFYADPSNSGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSN 838
            :.....||::.||||   ...:|:.:.|.  :::| |.|||.||:::..:   .|..|.||||..
Human   269 LHTSAKVLILVLKRF---SDVTGNKLAKN--VQYP-ECLDMQPYMSQQNT---GPLVYVLYAVLV 324

  Fly   839 HYG-TMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886
            |.| :...|||.::.| |..|:|:|.||..|:|...::|:|..||:|||
Human   325 HAGWSCHDGHYFSYVK-AQEGQWYKMDDAKVTACSITSVLSQQAYVLFY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 98/348 (28%)
Peptidase_C19R 564..887 CDD:239139 100/348 (29%)
USP17L2NP_958804.2 Peptidase_C19E 79..373 CDD:239126 101/357 (28%)
UCH 80..372 CDD:278850 98/347 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..416
Mediates interaction with SUDS3. /evidence=ECO:0000269|PubMed:21239494 399..530
HABP4_PAI-RBP1 <426..454 CDD:282609
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 490..530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.