DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp29

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_001101935.1 Gene:Usp29 / 361495 RGDID:1306648 Length:872 Species:Rattus norvegicus


Alignment Length:442 Identity:101/442 - (22%)
Similarity:171/442 - (38%) Gaps:110/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 LESKAQDYIVENNRLREELSRIQELHNVTQQLSQKEVEATRNIESKIRERQRLDEQHELERQERE 467
            :|...:|.:.|||..:::.||..               .:||...|..:...|.||.:....:.|
  Rat   188 VEVTTKDILKENNPEQKKKSRRY---------------YSRNRGGKAEKAVALREQEKRNNWKLE 237

  Fly   468 RLLAIARETKKHYKSPTPSGPPSPGRNLEDVHVVSDSLESLLQLTGDPDPTIAPNKAEIPTFDRA 532
            ...     :.|.|...|..|...|      :...||..:  |.:.|          .||.|.: .
  Rat   238 PAF-----SSKVYGKSTLDGTVLP------IATCSDDRD--LSIFG----------LEIITHN-G 278

  Fly   533 MKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYK 597
            ::|.|.|..:..:|                .|..|||||||||||||.:...|...:..:     
  Rat   279 IQPPPDNYLKQLKR----------------EGFPNLGNTCYMNSILQSVFGIPTFAKDLL----- 322

  Fly   598 NYISRSNKTNGQVIEEVA-----------ALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQ 651
                    |.|...|:|:           .::|::.:.:.|......::..:......|.|.:|.
  Rat   323 --------TQGIPWEKVSYDDLIMPLSQLLVLKDIRDIEIKGELLTSVKKSISTVADTFSGNEQN 379

  Fly   652 DSHEFLTILMDWLHSDLQTLH----VPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKC 712
            |:||||::.:|.|..:::.::    ..|:.|...|..|.::....|.....||       |::.|
  Rat   380 DAHEFLSLCLDQLKLNMEKVNAMWDTERKNEPTCAGAKRFVCPVGANFEFELH-------SSIIC 437

  Fly   713 VACHKESATYESFSNLSLEL--PPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKRDAIKKLDIS 775
            ..|.:.:...|..:.||::|  ...::...:.:..|::|:.|:|. .||..||.| :::.|..:.
  Rat   438 EGCGEATLKTEVSNYLSIDLHHGTKTHPLSIQKSFDLFFTPEKIE-HNCEKCKNK-NSVLKYTLR 500

  Fly   776 KLPPVLVVHLKRFYADPS----------------NSGSYMKKQNYLRFPLEN 811
            :||.||:|||||:.....                |..|:..:...|.|||.|
  Rat   501 RLPRVLIVHLKRYQVTTDLLPVKSEQPVEISQYLNISSHCHENRKLPFPLIN 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 71/283 (25%)
Peptidase_C19R 564..887 CDD:239139 71/281 (25%)
Usp29NP_001101935.1 PH_USP37_like 4..109 CDD:270122
UCH 294..560 CDD:395355 71/281 (25%)
Peptidase_C19 <765..826 CDD:351799
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.