DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and ubp8

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_592992.1 Gene:ubp8 / 2542135 PomBaseID:SPAC13A11.04c Length:449 Species:Schizosaccharomyces pombe


Alignment Length:387 Identity:100/387 - (25%)
Similarity:162/387 - (41%) Gaps:99/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 DRAMKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEY---- 590
            |....|:..|.....:..|.:.||...   .||.|::|||.||:|:.|||.:.:.|.:...    
pombe   115 DHKRLPEKYNQMVCLEAYRKYPPVCAT---AGLRGIQNLGATCFMSVILQSILHNPLVRNLFFSG 176

  Fly   591 ---------------CISDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQ 640
                           .|.|.:.:..:..||:   ......|::..:|                 :
pombe   177 FHTSTDCKRPTCMTCAIDDMFSSIYNSKNKS---TFYGPTAVLNLMW-----------------K 221

  Fly   641 YQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESM-----ILH 700
            ..|...|..|||.|||...|:|.:|::                       :....||     |..
pombe   222 LSKSLCGYSQQDGHEFFVYLLDQMHTE-----------------------SGGGTSMPCTCPIHR 263

  Fly   701 LFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTK 765
            :|.|.:|:.|.|:.|.||....:...::||::    |...|..|::.:.|.|::. ::|.||.:|
pombe   264 IFSGSLKNVVTCLDCKKERVAVDPLMDISLDI----NEPTLQGCLERFVSKEKVQ-YSCHSCGSK 323

  Fly   766 RDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQ-NY-----LRFPLENLDMNPYIARAESR 824
             :|||:|...||||.:.:.||||..:.....:.:.|| :|     :|:.....|::         
pombe   324 -NAIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQVSYPAFLRMRYNFNQDDVD--------- 378

  Fly   825 AVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886
                  ||||:|..|.||::.|||.|:....|  :||..||..:..:..|.|::|.||:|||
pombe   379 ------YQLYSVVCHKGTLDTGHYIAYTYYQN--QWFLLDDTTIVEVKESEVLNSQAYLLFY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 91/353 (26%)
Peptidase_C19R 564..887 CDD:239139 92/353 (26%)
ubp8NP_592992.1 ZnF_UBP 37..85 CDD:197632
UCH 144..432 CDD:278850 91/353 (26%)
Peptidase_C19D 145..433 CDD:239125 92/354 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.