DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and ubp1

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_587999.1 Gene:ubp1 / 2539228 PomBaseID:SPCC16A11.12c Length:849 Species:Schizosaccharomyces pombe


Alignment Length:575 Identity:128/575 - (22%)
Similarity:201/575 - (34%) Gaps:255/575 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTN--GQVIEEVAALIKELWN 623
            ||.||.||||:|||||.|||:.:|.:||:|.:||.|:..|:.:|...  |:|....|:|:|.:.:
pombe   277 GLCGLYNLGNSCYMNSALQCMIHTHELTKYFLSDSYEKDINYNNPLGMMGKVALSYASLLKMIHH 341

  Fly   624 -GQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDL-----------------QT 670
             .....|:....::::|::...|.|..||||.||:...:|.||.||                 ..
pombe   342 TADMHSVSPSSFKFIIGEFNTYFSGYRQQDSQEFIAFFLDGLHEDLNRIQIKPYFERPDLFDEHP 406

  Fly   671 LHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPN 735
            |||.|      .:.:.|...||..:|:|:.||.|..|||::|..|:::|..::.|..|:|.||.:
pombe   407 LHVQR------VANQCWDIHTKRNDSIIVQLFQGMYKSTLECSICYQKSTAFDPFMYLTLPLPTS 465

  Fly   736 ----------------------------SNVCQLN------------QC-----MDMYFS----- 750
                                        |.|.|:.            :|     .|:|..     
pombe   466 AKWRHKVVYVPPFGTQSPVELYLELLMESTVIQMKFQATEKLQKMGLECGELTACDIYRGKVYKV 530

  Fly   751 -------GERIHGWN-------------------------------------------------- 758
                   .::||.|:                                                  
pombe   531 LKNKDKISKKIHKWDHVVLYGSTANGLTIPIVHGCKRPAMPGSYQSNDVFGFPLQLNVRSRNVLT 595

  Fly   759 ----------------------------------------------------------------- 758
                                                                             
pombe   596 NDLVKEIVELYRVYAGIDVAIGTLQLGLKRMESKAGKWECIKEIEVKRFEIVEEEEIVIDDKTVI 660

  Fly   759 ----------------------------------------------------CPSCKTKRDAIKK 771
                                                                ||.||..|.|.|:
pombe   661 MCLWNDQQYEKLFYNCEWIFEKIQFHMESITLEDCLLEFSKPEQLDLQDSWYCPGCKAFRPATKR 725

  Fly   772 LDISKLPPVLVVHLKRFYADPSNSGSYMKKQNYLRFPLENLD----MNPYIARAE-SRAVTPKTY 831
            |:|.:||.:||:||.||.....:.....|:::.:.:|:.:|:    ::|:|...| ..:.....|
pombe   726 LEIWRLPKILVIHLNRFSGHGGDLRRRRKRRDLVVYPVFDLNLKQFLSPFIKDHEWLSSQKSMLY 790

  Fly   832 QLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886
            .||||.||:|.|..|||||:.:.|:...:|||||..:..:|..::|:|:||:|||
pombe   791 DLYAVDNHHGFMSNGHYTAYARDASSQTFFKFDDTAICEIDPEDIVTSSAYVLFY 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 125/572 (22%)
Peptidase_C19R 564..887 CDD:239139 126/572 (22%)
ubp1NP_587999.1 UBP12 1..849 CDD:227847 128/575 (22%)
DUSP 45..123 CDD:197831
Peptidase_C19 280..>472 CDD:271592 66/197 (34%)
Peptidase_C19 280..>394 CDD:271592 43/113 (38%)
Peptidase_C19R <690..846 CDD:239139 51/156 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21646
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.