DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp17lc

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:NP_034219.3 Gene:Usp17lc / 13532 MGIID:107698 Length:545 Species:Mus musculus


Alignment Length:427 Identity:119/427 - (27%)
Similarity:187/427 - (43%) Gaps:114/427 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 PSGPP---SPGRNLEDVHVVSDSLESLLQLTGDPDPTIAPNKAEIPTFDRAMKPQPRNVERTSQR 546
            |...|   |||  .:.:|  .|..:.:::||.:..|:::   .|.|.                  
Mouse     8 PEADPALSSPG--AQQLH--QDEAQVVVELTANDKPSLS---WECPQ------------------ 47

  Fly   547 VRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKN------------- 598
                        |.| .||:|.||:||:|:.||||::||.|.:|.:|.:|..             
Mouse    48 ------------GPG-CGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEYSQTCCSPEGCKMCAM 99

  Fly   599 --YISRS--NKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTI 659
              ::::|  :..:|.|::....|                        ...|....|:|:||||..
Mouse   100 EAHVTQSLLHSHSGDVMKPSQIL------------------------TSAFHKHQQEDAHEFLMF 140

  Fly   660 LMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILH-LFYGQMKSTVKCVACHKESATYE 723
            .::.:|.  ..|.|.||.|..|            ::|..:| :|.|..:|.:||:.|...|.||:
Mouse   141 TLETMHE--SCLQVHRQSEPTS------------EDSSPIHDIFGGLWRSQIKCLHCQGTSDTYD 191

  Fly   724 SFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWN---CPSCKTKRDAIKKLDISKLPPVLVVHL 785
            .|.::.|::   |:...:||.:......|.:.|.|   |..|:.|..|.|.|.|...|.||::.|
Mouse   192 RFLDVPLDI---SSAQSVNQALWDTEKSEELRGENAYYCGRCRQKMPASKTLHIHSAPKVLLLVL 253

  Fly   786 KRFYADPSNSGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYG-TMEGGHYT 849
            |||.|...|     |....:.:| |.||:.||:::...   .|..|.||||..|.| |...|||.
Mouse   254 KRFSAFMGN-----KLDRKVSYP-EFLDLKPYLSQPTG---GPLPYALYAVLVHEGATCHSGHYF 309

  Fly   850 AFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886
            ::.| |.:|.|:|.||..|::.|.::|::..||:|||
Mouse   310 SYVK-ARHGAWYKMDDTKVTSCDVTSVLNENAYVLFY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 103/345 (30%)
Peptidase_C19R 564..887 CDD:239139 105/345 (30%)
Usp17lcNP_034219.3 Peptidase_C19E 50..346 CDD:239126 106/348 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..442
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.