DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp8 and Usp37

DIOPT Version :9

Sequence 1:NP_650948.2 Gene:Usp8 / 42509 FlyBaseID:FBgn0038862 Length:896 Species:Drosophila melanogaster
Sequence 2:XP_006245354.1 Gene:Usp37 / 100361658 RGDID:2319715 Length:979 Species:Rattus norvegicus


Alignment Length:542 Identity:123/542 - (22%)
Similarity:216/542 - (39%) Gaps:98/542 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 TIDDIEYPSIHDITMKEDISAKDFRPRPDFNRANKPAATRVNEQGISRPSPPAKPIAEIMRDQAE 359
            |:.|..:.||..:..|:   |::.|...|....|:..|...:.||    |.....|......|.|
  Rat    75 TLQDNSFLSIDKVPSKD---AEEMRLFLDAVHQNRLHAAMKSSQG----SGSFGTILGSRTSQKE 132

  Fly   360 FLQRAEQNDEQ-------LEKASKMWKR-----------QAAEGDGLNATE--------DQELHF 398
            ..::...:|.|       ||...::..|           :...|.|:..|.        ...|..
  Rat   133 TNRQLSYSDNQASSKRGSLETKDEIPFRKVLGNPGRGPIKTVTGSGMAVTRTIPSLTLTSTPLRT 197

  Fly   399 RILQLESKAQDYIVENNRLREELSRIQELHNVTQQLSQKEVEATRNIESKIRERQRLDEQHELER 463
            .:|:..::.:..::..:.|.|:..:    .|.:...::...:.:|...|..||:|.     .|::
  Rat   198 GLLENRTEKRKRMLSGSELTEDYPK----ENDSSSNNKAMTDPSRKYLSSSREKQL-----SLKQ 253

  Fly   464 QERER---LLAIARETKKHYKSPTPSGP-PSPGRNLEDVHVVSDSLESLLQLTGDPDPTIAPNKA 524
            .|..|   ||.:  ::...|.|.|.|.. .|.|.||:..::.:.:..:...|...|.||      
  Rat   254 AEENRTPGLLPL--QSSSFYGSRTGSKDYSSGGTNLDRCNISNQTPSAKRSLGFLPQPT------ 310

  Fly   525 EIPTFDRAMKPQPRNVERTSQRVRDFSPVIGQNVGRG--------LTGLKNLGNTCYMNSILQCL 581
                        |.:|    :::|......|.|..|.        |.|..|||||||||:|||.|
  Rat   311 ------------PLSV----KKLRCNQDYTGWNKPRAPLSSHQQQLQGFSNLGNTCYMNAILQSL 359

  Fly   582 SNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAALI--KELWNGQYKCVASRDLRYVVGQYQKI 644
            .:.....    :|..|..|.........:|...|.|:  |::.|.:.|....:.::..:....:.
  Rat   360 FSLQSFA----NDLLKQSIPWKKIPLNALIRRFANLLIKKDISNSETKKELLKKVKNAISATAER 420

  Fly   645 FRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKA-WLEFTKAKESMILHLFYGQMKS 708
            |.|..|.|:||||:..:|.|..|::.|:...:.|.:...|.: ....||.....::.....:::.
  Rat   421 FSGYVQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVLGEENSPDTSATKVFTCPVITNLEFEVQH 485

  Fly   709 TVKCVACHKESATYESFSNLSLE-------LPPNSNVCQLNQCMDMYFSGERIHGWNCPSCKTKR 766
            ::.|.||.:.....|.|::||::       |||.|    :...:|::|..|.:. ::|..|..| 
  Rat   486 SIICKACGETIPKREQFNDLSIDLPRRKKPLPPRS----IQDSLDLFFRAEELE-YSCEKCGGK- 544

  Fly   767 DAIKKLDISKLPPVLVVHLKRF 788
            .|:.:....:||.||::||||:
  Rat   545 CALVRHKFIRLPRVLILHLKRY 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp8NP_650948.2 USP8_dimer 2..113 CDD:286108
RHOD 148..278 CDD:294087
UCH 562..886 CDD:278850 66/237 (28%)
Peptidase_C19R 564..887 CDD:239139 65/235 (28%)
Usp37XP_006245354.1 UCH_N 3..104 CDD:293279 8/31 (26%)
Peptidase_C19 342..>603 CDD:239072 65/235 (28%)
UCH 342..>600 CDD:278850 65/235 (28%)
Peptidase_C19 <881..949 CDD:239072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.