DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and Mrm2

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_080786.1 Gene:Mrm2 / 68017 MGIID:1915267 Length:246 Species:Mus musculus


Alignment Length:212 Identity:68/212 - (32%)
Similarity:114/212 - (53%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRT-------SKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVL 59
            |||       ::..:|.|.:.||.:.:|.|||||||:.:|..|:|....|.:|..||||:||||.
Mouse    26 GRTGAEHLWLTRHLKDPFVKAAKVESYRCRSAFKLLEMNEKHQILRPGLRVLDCGAAPGAWSQVA 90

  Fly    60 AKRLYEPLPPEEREKVKIIAVDLQGMAPIEGVKQL-RADISKESTAEAIIEFFGGEKAQIVVSDG 123
            .:|:.............::.|||..:.|:.|...| .||::...|.:.|:|.....:|.:::||.
Mouse    91 VQRVNATGADSSSPVGFVLGVDLLHIFPLAGATFLCPADVTDPRTFQKILELLPSRRADVILSDM 155

  Fly   124 APDSTGMHDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKP 188
            ||::||:.|.|......|.|:.:.::..||..||:.:.|.:...::..|..:|.:.|::..|.||
Mouse   156 APNATGIRDLDHDKLISLCLTLVDMAVDILHPGGTLLCKTWAGSKSHLLQKRLTQEFQSTRVVKP 220

  Fly   189 SASRNSSIEAFVVAREF 205
            .|||..|.|.:::|.::
Mouse   221 EASRKESSEVYLLATQY 237

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 66/208 (32%)
Mrm2NP_080786.1 RlmE 33..239 CDD:223370 65/205 (32%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q9UI43 83..86 2/2 (100%)