DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and CG11447

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_650835.1 Gene:CG11447 / 42359 FlyBaseID:FBgn0038737 Length:250 Species:Drosophila melanogaster


Alignment Length:201 Identity:58/201 - (28%)
Similarity:93/201 - (46%) Gaps:9/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYEPLPPEEREK 74
            |.:...|:...:|.|||||||:.|:.:.:|......::..||||||:||..:|.......|...:
  Fly    48 DPYVEKARMMNYRCRSAFKLLEIDDKYGILRPGDTVLECGAAPGSWTQVAVERTNANGKQERAPQ 112

  Fly    75 VKIIAVDLQGM-----APIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHDFD 134
            ..:.::||...     |.|.|.....:.::::...||:.:    .|...|:||.||::||:...|
  Fly   113 GAVFSIDLLHFHAVPGATIFGGMDFTSSLAQKRLREALQD----RKVNCVLSDMAPNATGVRMLD 173

  Fly   135 SYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSSIEAF 199
            ......|....|..:..:.......|.|::......:|...:.||::.|...||.|||..|.|.|
  Fly   174 QESITNLCYEVLRFALAMSAPQAHLVVKVWDNGDVPKLERDMLRFYEKVKRVKPRASRGDSAEHF 238

  Fly   200 VVAREF 205
            :|||.|
  Fly   239 LVARNF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 57/199 (29%)
CG11447NP_650835.1 RlmE 35..246 CDD:223370 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.