DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and CG8939

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_573099.1 Gene:CG8939 / 32568 FlyBaseID:FBgn0030720 Length:817 Species:Drosophila melanogaster


Alignment Length:234 Identity:90/234 - (38%)
Similarity:129/234 - (55%) Gaps:11/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65
            :|:|.|||   ||:||||.|.|:|:||||:|.:..|..|:.....:|||||||.|.||..:.:  
  Fly     7 VGKTRKDK---FYQLAKETGLRSRAAFKLIQLNRKFGFLQQSQVCLDLCAAPGGWMQVAKQNM-- 66

  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130
            |:      ...:|.|||..:.||.|...|..||:.|...:::.:.....||.:|:.||||:....
  Fly    67 PV------SSIVIGVDLFPIRPIAGCIGLVEDITTEKCRQSLTKELQSWKADVVLHDGAPNVGRN 125

  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            ..:|:|.|..|.|:||.:||..|..||.||:|::|:...:.|...||:.||.|...||||||..|
  Fly   126 WLYDAYQQICLTLNALKLSTQFLRNGGWFVTKVFRSKDYNALLWVLKQLFKKVHATKPSASRKES 190

  Fly   196 IEAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKES 234
            .|.|||.:.:..||...|..|.:::..:......:||.|
  Fly   191 AEIFVVCQGYLAPDHIDPRLLDSKYVFEELDLDAKKKSS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 82/200 (41%)
CG8939NP_573099.1 RlmE 8..203 CDD:223370 83/205 (40%)
DUF3381 233..366 CDD:288694
Spb1_C 611..803 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440467
Domainoid 1 1.000 98 1.000 Domainoid score I367
eggNOG 1 0.900 - - E1_COG0293
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.