DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and ftsj3

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001292397.1 Gene:ftsj3 / 321247 ZFINID:ZDB-GENE-030131-9828 Length:838 Species:Danio rerio


Alignment Length:374 Identity:110/374 - (29%)
Similarity:169/374 - (45%) Gaps:99/374 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65
            :|:|.|||   ||.||||.|:|:||:|||:|.:..||.|:.....||||||||.|.||.:|  :.
Zfish     7 VGKTRKDK---FYHLAKETGYRSRSSFKLIQLNRKFQFLQKARALVDLCAAPGGWLQVASK--FM 66

  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130
            |:      ...:|.|||..:.||..|..|:.||:.|...:|:.:.....|..:|::||||:....
Zfish    67 PV------SSLVIGVDLVPIKPIPNVVTLQEDITTEKCRQALRKELQTWKVDVVLNDGAPNVGAN 125

  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            ...|::.|..|.|.||.::...|.:||:|::|::|:.....|....::|||.|...||.||||.|
Zfish   126 WQHDAFSQANLTLMALKLACEFLAKGGTFITKVFRSKDYQPLMWIFQQFFKKVQATKPQASRNES 190

  Fly   196 IEAFVVAREFCLPD-----------------------------------GYKPCNLT-------T 218
            .|.|||.:.|..||                                   ||...:||       |
Zfish   191 AEIFVVCQGFLAPDKIDNKFFDPKHAFKEVDVQVKTVKELVNKKKPKAEGYSDGDLTLYHKFTIT 255

  Fly   219 EWHDQPESWVGRKKESPPVVQVPFVAYKGELDSDRTYDLGENYVYKEPV--QQPLTAAYQDILQK 281
            |:         .|.|:|    |.|::...|:    |:|        :|:  ..|||:|  :|.:.
Zfish   256 EF---------LKAENP----VDFLSKANEI----TFD--------DPLLESHPLTSA--EIREC 293

  Fly   282 TSQVNI-----------------KYEGIRVIHDEEMLKKWLENDENKSE 313
            .|.|.:                 |:...::..:.:.|.:...:|:.:|:
Zfish   294 CSDVKVLGRKELRLLLSWRSKLRKFLAKKLRQEAKQLDQEASSDDEQSD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 80/200 (40%)
ftsj3NP_001292397.1 RlmE 4..203 CDD:223370 82/206 (40%)
DUF3381 233..377 CDD:288694 26/137 (19%)
Spb1_C 624..819 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.