DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and MRM2

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_037525.1 Gene:MRM2 / 29960 HGNCID:16352 Length:246 Species:Homo sapiens


Alignment Length:202 Identity:74/202 - (36%)
Similarity:117/202 - (57%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRL----YEPLPP 69
            ||.|.:.||.:.:|.|||||||:.:|..|:|....|.:|..||||:||||..:::    .:|..|
Human    40 RDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSP 104

  Fly    70 EEREKVKIIAVDLQGMAPIEGVKQL-RADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHDF 133
            ..    .::.|||..:.|:||...| .||::...|::.|:|...|.:|.:::||.||::||..|.
Human   105 VG----FVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDL 165

  Fly   134 DSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSSIEA 198
            |......|.|:.||::..||:.||:|:.|.:...::.||..:|...|:||.:.||.|||..|.|.
Human   166 DHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEV 230

  Fly   199 FVVAREF 205
            :.:|.::
Human   231 YFLATQY 237

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 74/200 (37%)
MRM2NP_037525.1 RlmE 33..241 CDD:223370 74/202 (37%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000269|Ref.9 83..86 2/2 (100%)