DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and FTSJ1

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_036412.1 Gene:FTSJ1 / 24140 HGNCID:13254 Length:329 Species:Homo sapiens


Alignment Length:294 Identity:147/294 - (50%)
Similarity:199/294 - (67%) Gaps:17/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65
            ||||||||||::||||||.||||||||||||.|:.|||.:|:|||||||||||||||||::::  
Human     1 MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKI-- 63

  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130
                ..:....::|||||.|||:.||.|::.||::.|||:.||:.|.|..|.:||.|||||.||:
Human    64 ----GGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGL 124

  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            ||.|.|:|.:|||:||:|:|.:|:.||.||:||:|....:.||:||:.||.:|...||.:|||||
Human   125 HDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSS 189

  Fly   196 IEAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKESPPVVQVPFVAYKGEL---DSDRTYDL 257
            ||||.|.:.:..|:|:.| :|:....|........:.:.|..:.||||.. |:|   ||||:|.|
Human   190 IEAFAVCQGYDPPEGFIP-DLSKPLLDHSYDPDFNQLDGPTRIIVPFVTC-GDLSSYDSDRSYPL 252

  Fly   258 ----GENYVYKEPVQQPLTAAYQD--ILQKTSQV 285
                |..|.|..|.|.|::..||:  .|::..|:
Human   253 DLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 116/200 (58%)
FTSJ1NP_036412.1 RlmE 4..203 CDD:223370 116/204 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150789
Domainoid 1 1.000 216 1.000 Domainoid score I2694
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S638
OMA 1 1.010 - - QHG54241
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 1 1.000 - - FOG0004400
OrthoInspector 1 1.000 - - otm40504
orthoMCL 1 0.900 - - OOG6_102125
Panther 1 1.100 - - O PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3115
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.670

Return to query results.
Submit another query.