DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and F45G2.9

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_499776.1 Gene:F45G2.9 / 185813 WormBaseID:WBGene00009735 Length:214 Species:Caenorhabditis elegans


Alignment Length:205 Identity:64/205 - (31%)
Similarity:99/205 - (48%) Gaps:14/205 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYEPLPPE 70
            :...|.|...|:|..:||||||||::.:|.|:.|:..:..:|:..|||||.||:.::.     |.
 Worm    17 RQSTDEFAVKAREHNYRARSAFKLIEINEKFKFLKPESTVIDIGCAPGSWLQVVVQKC-----PN 76

  Fly    71 EREKVKIIAVDLQGMAPIEGVKQLR-ADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHDFD 134
            ....    .||||.:.||.|...|. :||:..:....|.|.....:..:|:||.||:.||.:..|
 Worm    77 GYAS----GVDLQNVLPIRGADILSLSDITDPAVKLKIREKLAHRQVDVVLSDMAPNPTGDNATD 137

  Fly   135 SYVQGELLLSA---LSISTFI-LEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            .....||..|.   .|:...| |.:.|.::.||:.....:....:|...|..|...||:|.|::|
 Worm   138 HLRLIELCRSVFRLFSVENEIELVKNGVYLCKIWDGSARAEFVRELSDRFSTVKTVKPTACRDNS 202

  Fly   196 IEAFVVAREF 205
            .|.::..|.|
 Worm   203 AELYLFCRNF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 63/203 (31%)
F45G2.9NP_499776.1 RlmE 4..214 CDD:223370 64/205 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.