DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and R74.7

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_497843.1 Gene:R74.7 / 175543 WormBaseID:WBGene00011281 Length:337 Species:Caenorhabditis elegans


Alignment Length:299 Identity:144/299 - (48%)
Similarity:199/299 - (66%) Gaps:30/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65
            ||:||:|||||:||||||..|||||||||:|.|:.||:|:|:.||||||||||||||||:|||| 
 Worm     1 MGKTSRDKRDIYYRLAKENKWRARSAFKLMQIDDEFQILKGVRRAVDLCAAPGSWSQVLSKRLY- 64

  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130
                ||.::.||:|:|||.||||.||.||:.||:...||..:|:.|.|||:.||:.|||||.||:
 Worm    65 ----EEDQEAKIVAIDLQPMAPIPGVIQLQGDITSVDTANQVIKHFSGEKSDIVICDGAPDVTGI 125

  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            |..|.::|.||:|:|.:|::.:|:|||:|::||:|:..:|.||.|:|::||.|.:.||.:||.||
 Worm   126 HSLDEFMQAELILAAFNITSHVLKEGGNFLAKIFRSRNSSLLYAQMKKYFKKVYLAKPRSSRQSS 190

  Fly   196 IEAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKESPPVVQVPFVAYKGEL---DSDRTYDL 257
            .||||:..::..|:|:.|....|.......|.:     ||.::. .||.. |:|   ||:::|.|
 Worm   191 CEAFVLCLDYSPPEGFVPTMGKTSLDATDASAI-----SPDIID-GFVTC-GDLSGWDSEKSYPL 248

  Fly   258 --------GE-------NYVYKEPVQQPLTAAYQDILQK 281
                    ||       .|.:|:.||.|...||:..|.|
 Worm   249 DIDACFPKGEIDEEQKKRYEFKDVVQPPTDPAYKAALDK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 116/200 (58%)
R74.7NP_497843.1 RlmE 3..204 CDD:223370 116/205 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54241
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 1 1.000 - - FOG0004400
OrthoInspector 1 1.000 - - otm14685
orthoMCL 1 0.900 - - OOG6_102125
Panther 1 1.100 - - O PTHR10920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3115
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.