DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and ftsj3

DIOPT Version :9

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_012822455.1 Gene:ftsj3 / 100145257 XenbaseID:XB-GENE-5797493 Length:850 Species:Xenopus tropicalis


Alignment Length:320 Identity:102/320 - (31%)
Similarity:149/320 - (46%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYEPL 67
            :..|.::|.||.||||.|:|:||||||:|.:..||.|......||||||||.|.||.||  :.|:
 Frog     6 KVGKSRKDKFYHLAKETGYRSRSAFKLIQLNRKFQFLPKARALVDLCAAPGGWLQVAAK--FMPI 68

  Fly    68 PPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMHD 132
                  ...||.|||..:.||..|..|:.||:.|:..:.:.:.....||.:|::||||:......
 Frog    69 ------SSLIIGVDLVPIKPIPKVLTLQEDITTEACRQTVRKHLQTWKADVVLNDGAPNVGANWT 127

  Fly   133 FDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSSIE 197
            .|::.|..|.|.||.::...|..||.|::||:|:.....|...|::|||.|...||.|||:.|.|
 Frog   128 HDAFSQVHLSLMALRLACDCLSRGGWFITKIFRSSDYQSLLWILQQFFKKVNSTKPQASRSESAE 192

  Fly   198 AFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKESPPVVQVPFVAYKGELDSDRTYDLGENYV 262
            .|||.:.|..||     .:.|.:.|                  |..|:| ::|.. ...:.:...
 Frog   193 IFVVCQGFLAPD-----KIDTRFFD------------------PKFAFK-DVDGP-VQTVSQLLS 232

  Fly   263 YKEP-----------------------VQQPLTAAYQDILQKTSQVNIKYEGIRVIHDEE 299
            :|:|                       |:.|:     |.|.|||::        ::.|.|
 Frog   233 HKKPKAEGYAATSLSLYHRASLVDFLTVENPV-----DFLSKTSEI--------ILDDTE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 82/200 (41%)
ftsj3XP_012822455.1 RlmE 4..203 CDD:223370 83/204 (41%)
DUF3381 234..373 CDD:371767 11/59 (19%)
Spb1_C 647..850 CDD:369515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.