DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp93a and Obp50e

DIOPT Version :9

Sequence 1:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster


Alignment Length:199 Identity:42/199 - (21%)
Similarity:84/199 - (42%) Gaps:28/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YVYNLLFVVIVFSYCAKSFNYTSCDHAKQPKF----LSSCCDVQKND--KAINSCRKSLLGNNST 60
            |:....|::|:......|||.::     .|.|    :::||...:.|  .....|.|.:.|..|.
  Fly     4 YIICFGFLLIILECSLASFNCSA-----PPNFNNFDINTCCRTPELDMGDVPQKCHKYVSGLKSA 63

  Fly    61 NSNGEVRNLKSDKVALHACIAECSFRTNGFLLSNGTVNTQALQKSYQQR-YKNDPNMSQLMLKSL 124
            ||       |....| |.|..:|.:|..|.:: ||.:....:::..::. ::.|..:...:::|.
  Fly    64 NS-------KYPSYA-HLCYPDCIYRETGAMV-NGKIKVNRVKQYLEEHVHRRDQEIVSHIVQSF 119

  Fly   125 NSCTDYAR-----KRVQEFQWMPKKGDCDFYPATLLACVMEKVYINCPTSKWKNTSDCTAMWKYL 184
            .||....:     ..::.::.:|.  .|..:...:.:||..:.::|||...|||...|....::.
  Fly   120 ESCLSNVKGHMKSLNIESYKVLPH--GCSPFAGIIYSCVNAETFLNCPQQMWKNEKPCNLAKQFA 182

  Fly   185 VACD 188
            ..|:
  Fly   183 EQCN 186



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.