DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp93a and Obp47b

DIOPT Version :9

Sequence 1:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b / 36207 FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster


Alignment Length:195 Identity:38/195 - (19%)
Similarity:82/195 - (42%) Gaps:21/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVIVFSYCAKS----FNYTSCDHAKQPKFL--SSCCDVQKNDKAINSCRKSLLGNNSTNSNGEVR 67
            ::::|:..|.:    |...:.|..:.|:.:  :.||.....|:....|.:.:||..:....|...
  Fly     6 LLVIFASLALNTRLVFGQATIDCQRPPQLVDPALCCKDGGRDQVAEQCAQRILGTANGQKAGGPP 70

  Fly    68 NLKSDKVALHACIAECSFRTNGFLLSNGTVNTQALQKSYQQRYKNDPNMSQLMLKSLNSCTDYAR 132
            :|.:     .||:|||...::.::.....:|...::.....::.||....:.|..:.:.|...::
  Fly    71 SLDT-----AACLAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLYVETMTMAFSKCEPQSQ 130

  Fly   133 KR----------VQEFQWMPKKGDCDFYPATLLACVMEKVYINCPTSKWKNTSDCTAMWKYLVAC 187
            :|          ||:.:...::..|..:.|.:|.|...:.:.|||..:|...:.||....|:..|
  Fly   131 RRLAMIMQQQQQVQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTLAKAYVTQC 195

  Fly   188  187
              Fly   196  195



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.