DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp93a and Obp46a

DIOPT Version :9

Sequence 1:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_610574.1 Gene:Obp46a / 36088 FlyBaseID:FBgn0033508 Length:198 Species:Drosophila melanogaster


Alignment Length:163 Identity:36/163 - (22%)
Similarity:65/163 - (39%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CCDVQKNDKAINSCRKSLLGNNSTNSNGEVRNLKSDKVALHACIAECSFRTNGFL-LSNGTVNTQ 100
            |||:.......:.|:..........::.|.:...       .|.|||||.:..|| ....::|..
  Fly    42 CCDLHDESPQFSDCQMEWHEKIPYETDEEEQTYM-------FCTAECSFNSTNFLGRDRRSLNLN 99

  Fly   101 ALQKSYQQRYKNDPNMSQLMLKSLNSCTDYARKRVQEFQWMPKKG-----------DCDFYPATL 154
            .:::..:....||.:: :|:..:...|..:|      ...||.||           .|..||..:
  Fly   100 EVKEHLESDLVNDADI-KLLYDTYVKCDKHA------LSLMPHKGVKQLSKRLSRLGCHPYPGLV 157

  Fly   155 LACVMEKVYINCPTSKWKNTSDCTAMWKYLVAC 187
            |.||..::.::|||.:::.|:.|.....:|..|
  Fly   158 LECVANEMILHCPTKRFRQTAQCEETRNHLKQC 190



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.