DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp93a and Obp50b

DIOPT Version :9

Sequence 1:NP_650945.1 Gene:Obp93a / 42506 FlyBaseID:FBgn0038859 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_725386.1 Gene:Obp50b / 246435 FlyBaseID:FBgn0050073 Length:238 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:55/175 - (31%) Gaps:34/175 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LSSCCDVQKNDKAINSCRKSLL------GNNST---NSNGEVRNLKSDKVALHACIAECSFRTNG 89
            |..|.::....|.:..|.||.|      |:|.|   :..|             .|..||.:|...
  Fly    27 LQKCTELLNTHKLVYCCGKSFLDKFPFVGSNCTPFWDDYG-------------PCRYECLYRHWD 78

  Fly    90 FLLSNGTVNTQALQKSYQQRYK--NDPNMSQLMLKSLNSCTDYARKRVQEF------QWMPKKG- 145
            .|..:..:....|.......|.  |..:......|:.:...:....|..:|      |...|.| 
  Fly    79 LLDQDNKIKKPELYLMITSLYSPLNGYDKYGAAFKAAHETCEALGSRHADFLLLYSNQVADKMGM 143

  Fly   146 ---DCDFYPATLLACVMEKVYINCPTSKWKNTSDCTAMWKYLVAC 187
               .|..|......|.|..:..|||...|.:...|.::.|.|.:|
  Fly   144 ASSTCLPYAMLHAQCTMVYLTANCPRENWIDDPKCNSLQKLLSSC 188



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.