DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and CAF4

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_012962.3 Gene:CAF4 / 853908 SGDID:S000001744 Length:643 Species:Saccharomyces cerevisiae


Alignment Length:539 Identity:110/539 - (20%)
Similarity:212/539 - (39%) Gaps:129/539 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ETNSNAQAFTTTMLYDPVRKKDSSPTYQTERELCFQYFTQWSESGQVDFVEHLLSRMCHYQHGQI 76
            |||....:...|:..|.:.:.||.......|:|                  .:|.|:.|......
Yeast   169 ETNVENLSINKTLEMDELTRLDSMINELESRKL------------------KILERVKHIDSKST 215

  Fly    77 NAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKV 141
            |      |:.| :||:         ::.:::::..:|::..           |..|.|::.|.:.
Yeast   216 N------LEND-VTLI---------KDRINFIEEYNLEADR-----------EQSLRKQMEEERS 253

  Fly   142 RTDSLWRGLAERRNWMQYLFKPRPGQT----------QRPHSFHRELFPKIMNDIDSIENNWRTG 196
            ...|   ...:....:..|.......|          ::.|..:|::          |...:...
Yeast   254 SEAS---SFTQNEEAISSLCDVESKDTRLKDFYKMPHEKSHDKNRQI----------ISETYSRN 305

  Fly   197 RHMLRRINCRSENSKGVYCLQYDD--GKIV-SGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQY 258
            ....|......|:...:..|.:|.  |.:. |..:|..:|:||......|..|.||..:|.|:|.
Yeast   306 TTAFRMTIPHGEHGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQI 370

  Fly   259 DDK---VIISGSSDSTVRVWDVN---------------TGEMVNTLIH----HCEAVLHLRFNNG 301
            |.|   ::|:||.|:|:::||:|               |.|:|...||    |.:.:..|.|::.
Yeast   371 DKKNYNMLITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSE 435

  Fly   302 MMVTCSKDRSIAVWDMT------------SPSEITLR---------RVLVGHRA-AVNVVDFDEK 344
            .:|:.|:|:.|..||:|            :|:...::         ..|:|..| .:..:.....
Yeast   436 ALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNS 500

  Fly   345 YIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVL 409
            .:.:.:.|..:::|.....:.||.|.||..||..|::....:|:||.|||:|:||:...:.|.|:
Yeast   501 ALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVI 565

  Fly   410 EGHEELVRCIRFDTKRIVSGAYDGKIKVWDL------VAALDPRAASNTLCLNTLVEHTGRVFRL 468
             .::..|..:.||.|.|..||.:|.:.|:::      :....|.:....       |.:.|:..:
Yeast   566 -AYDLPVSSLDFDGKLITVGANEGGVNVFNMERDEHWMTPEPPHSLDGD-------ELSRRIAIV 622

  Fly   469 QFDEFQIVSSSHDDTILIW 487
            ::.:..:::..:|..|.:|
Yeast   623 KYKDGFLINGHNDGDINVW 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940 4/37 (11%)
F-box-like 89..136 CDD:289689 6/46 (13%)
WD40 <192..495 CDD:225201 82/349 (23%)
WD40 210..488 CDD:238121 80/331 (24%)
WD40 repeat 213..248 CDD:293791 10/37 (27%)
WD40 repeat 254..288 CDD:293791 15/51 (29%)
WD40 repeat 293..330 CDD:293791 10/57 (18%)
WD40 repeat 337..370 CDD:293791 4/32 (13%)
WD40 repeat 376..410 CDD:293791 13/33 (39%)
WD40 repeat 416..459 CDD:293791 10/48 (21%)
WD40 repeat 465..487 CDD:293791 2/21 (10%)
CAF4NP_012962.3 Caf4 65..124 CDD:402971
WD40 318..641 CDD:238121 79/330 (24%)
WD40 repeat 322..360 CDD:293791 10/37 (27%)
WD40 repeat 366..422 CDD:293791 17/55 (31%)
WD40 repeat 427..461 CDD:293791 9/33 (27%)
WD40 repeat 472..526 CDD:293791 7/53 (13%)
WD40 repeat 532..563 CDD:293791 11/30 (37%)
WD40 repeat 571..611 CDD:293791 10/39 (26%)
WD40 repeat 617..641 CDD:293791 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.