DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and CDC4

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_116585.1 Gene:CDC4 / 850539 SGDID:S000001885 Length:779 Species:Saccharomyces cerevisiae


Alignment Length:541 Identity:141/541 - (26%)
Similarity:222/541 - (41%) Gaps:138/541 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETDKIMDETNSNAQAFTTTMLYDPVRKKDS--SPTYQTE-------RELCFQYFTQWSESGQVDF 60
            :|.|.::..|:.|         |.:..|||  ||.|.::       ..|...||.        :.
Yeast   199 KTTKTINNNNNIA---------DLIESKDSIISPEYLSDEIFSAINNNLPHAYFK--------NL 246

  Fly    61 VEHLLSRMCHYQHGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLR 125
            :..|::.|...:...:...:|..|:||.||.||.:    |:..|.:||..|.:.:|..|.:.|.:
Yeast   247 LFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFE----ISLKIFNYLQFEDIINSLGVSQNWNK 307

  Fly   126 VISEG-MLWKKLI--ERKVRT---DSLWRGLAERRNWMQYLFKPRPGQTQRPH-SFHRELFPKIM 183
            :|.:. .|||||:  |..|..   :||...|:::        .|:..|..|.. ||...:|    
Yeast   308 IIRKSTSLWKKLLISENFVSPKGFNSLNLKLSQK--------YPKLSQQDRLRLSFLENIF---- 360

  Fly   184 NDIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMG 248
                 |..||...:.:.:|...|...:..:.|||::|..:::|..|..|:::|..:.:.:..|.|
Yeast   361 -----ILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSG 420

  Fly   249 HTGSVLCLQY-DDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSI 312
            |.|.|..|:| ...:::|||:|.||||||:..|         |               |:     
Yeast   421 HDGGVWALKYAHGGILVSGSTDRTVRVWDIKKG---------C---------------CT----- 456

  Fly   313 AVWDMTSPSEITLRRVLVGHRAAVNVVDFDE----KYIVSASGDRTIKVW---STSSCE------ 364
                          .|..||.:.|..:|..|    ||||:.|.|.|:.||   ..||..      
Yeast   457 --------------HVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEH 507

  Fly   365 --------------FVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415
                          ||..|.||...:..:.....:|||||.||::.:||:....||.:|.||.:.
Yeast   508 DYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQMKCLYILSGHTDR 572

  Fly   416 VRCIRFD--TKRIVSGAYDGKIKVWDL----------VAALDPRAASNTL-CLNTLVEHTGRVFR 467
            :....:|  .||.:|.:.|..|::|||          .|.......:..| .:.||..||..|..
Yeast   573 IYSTIYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGL 637

  Fly   468 LQFDEFQIVSSSHDDTILIWD 488
            |:..:..:||::.|.:|..||
Yeast   638 LRLSDKFLVSAAADGSIRGWD 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940 5/37 (14%)
F-box-like 89..136 CDD:289689 16/47 (34%)
WD40 <192..495 CDD:225201 91/338 (27%)
WD40 210..488 CDD:238121 85/318 (27%)
WD40 repeat 213..248 CDD:293791 9/34 (26%)
WD40 repeat 254..288 CDD:293791 13/34 (38%)
WD40 repeat 293..330 CDD:293791 2/36 (6%)
WD40 repeat 337..370 CDD:293791 15/59 (25%)
WD40 repeat 376..410 CDD:293791 11/33 (33%)
WD40 repeat 416..459 CDD:293791 12/55 (22%)
WD40 repeat 465..487 CDD:293791 6/21 (29%)
CDC4NP_116585.1 CDC4_D 228..272 CDD:407099 7/51 (14%)
F-box-like 275..319 CDD:403981 16/47 (34%)
WD40 374..693 CDD:238121 89/328 (27%)
WD40 repeat 385..420 CDD:293791 9/34 (26%)
WD40 repeat 426..461 CDD:293791 16/77 (21%)
WD40 repeat 466..527 CDD:293791 16/60 (27%)
WD40 repeat 534..567 CDD:293791 11/32 (34%)
WD40 repeat 573..629 CDD:293791 12/55 (22%)
WD40 repeat 637..667 CDD:293791 7/22 (32%)
WD40 repeat 716..751 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.