DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and traf7

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001073654.1 Gene:traf7 / 563746 ZFINID:ZDB-GENE-070112-2212 Length:639 Species:Danio rerio


Alignment Length:422 Identity:117/422 - (27%)
Similarity:181/422 - (42%) Gaps:87/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VCKEWLRVISEGMLWKKLIERKVRTDSLWRGLAERRNWMQYLFKPRPGQTQRPHSFHRELFPKIM 183
            |||      .||:  |:.::   :||       :|.:.||...    .|..:..||.|.:..|:.
Zfish   250 VCK------FEGL--KEFLQ---QTD-------DRFHEMQVTL----AQKDQDISFLRSMLGKLS 292

  Fly   184 NDIDSIENN---------------------WRTGRHMLR----RINCRSE-------------NS 210
            ..:|.:|.|                     :|....||.    .||.|..             ..
Zfish   293 EKLDQLEKNLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKC 357

  Fly   211 KG--------VYCL-QYDDGKIV-SGLRDNTIKIWDR-TDLQCVKTLMGHTGSVLCLQYDDKVII 264
            ||        |:|| .|..|.:: ||..|.:||:||. |..:|.|||.||.|.||.|......:.
Zfish   358 KGTFVGHQGPVWCLCVYSTGDLLFSGSSDKSIKVWDTCTTYKCQKTLEGHDGIVLALCIQGNKLY 422

  Fly   265 SGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVL 329
            |||:|.|:.|||:.|.:.|||:..|...|..|..::.|:.:.|. ::|.|||:.. :|:.|::.|
Zfish   423 SGSADCTIIVWDIQTLQKVNTIRAHDNPVCTLVSSHNMLFSGSL-KAIKVWDIVG-TELKLKKEL 485

  Fly   330 VGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNS 394
            .|....|..:...:.::.|.| .:|||:|...|.|.|..|......:..:...:..:|.|:.:|.
Zfish   486 TGLNHWVRALVASQNHLYSGS-YQTIKIWDIRSLECVHVLQTSGGSVYSIAVTNHHIVCGTYENL 549

  Fly   395 IRLWDIECGACLRVLEGHEELVRCIRF----DTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCL 455
            |.:||||....:|.|.||...|..:..    |..::.|.:||..::||.:         .|.:|.
Zfish   550 IHVWDIESKEQVRTLTGHVGTVYALAVISTPDQTKVFSASYDRSLRVWSM---------DNMICT 605

  Fly   456 NTLVEHTGRVFRLQFDEFQIVSSSHDDTILIW 487
            .||:.|.|.|..|.....::.|.:.|.|:.:|
Zfish   606 QTLLRHQGSVTALAVSRGRLFSGAVDSTVKVW 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940
F-box-like 89..136 CDD:289689 6/16 (38%)
WD40 <192..495 CDD:225201 99/349 (28%)
WD40 210..488 CDD:238121 92/293 (31%)
WD40 repeat 213..248 CDD:293791 17/37 (46%)
WD40 repeat 254..288 CDD:293791 14/33 (42%)
WD40 repeat 293..330 CDD:293791 10/36 (28%)
WD40 repeat 337..370 CDD:293791 9/32 (28%)
WD40 repeat 376..410 CDD:293791 9/33 (27%)
WD40 repeat 416..459 CDD:293791 10/46 (22%)
WD40 repeat 465..487 CDD:293791 5/21 (24%)
traf7NP_001073654.1 RING 100..132 CDD:214546
Sina 141..>249 CDD:302762
Snapin_Pallidin 260..342 CDD:291383 19/95 (20%)
WD40 <349..637 CDD:225201 91/299 (30%)
WD40 357..637 CDD:238121 91/291 (31%)
WD40 repeat 368..406 CDD:293791 17/37 (46%)
WD40 repeat 412..446 CDD:293791 14/33 (42%)
WD40 repeat 451..486 CDD:293791 10/36 (28%)
WD40 repeat 493..525 CDD:293791 9/32 (28%)
WD40 repeat 531..565 CDD:293791 9/33 (27%)
WD40 repeat 573..608 CDD:293791 8/43 (19%)
WD40 repeat 615..637 CDD:293791 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44156
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.