DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and CG7568

DIOPT Version :10

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:289 Identity:81/289 - (28%)
Similarity:125/289 - (43%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SENSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQY---DDKVIISGSS 268
            |.|:...:.:.:.| |||:|..|.|.|:|..|..|.:.|..|||..::..::   |.|.|.:.|.
  Fly   182 SGNNLTTFSIIFSD-KIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASL 245

  Fly   269 DSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNG--MMVTCSKDRSIAVWDMTSPSEITLRRVLVG 331
            |.:.|::||.|...:..|.||...|:..|||..  |::|.|.|.|.|:||:.|.|   |...|.|
  Fly   246 DGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKS---LGHQLRG 307

  Fly   332 HRAAVN--VVDFDEKYIVSASGDRTIKVWST---------------------------------S 361
            |.|.::  |.:|....|.:.|.|.|.::|.|                                 |
  Fly   308 HSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSS 372

  Fly   362 SC-------------EFVRTLNGHKRGIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEG 411
            .|             |.:..:.||...::  |......::::.|:||:.|||..|.|.|.:||.|
  Fly   373 DCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAG 437

  Fly   412 HE-ELVRC-IRFDTKRIVSGAYDGKIKVW 438
            || |:..| ..:....|::.:.|...:.|
  Fly   438 HEGEVFSCAYSYAGDAILTASKDNSCRFW 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:463465
F-box_FBXW1B 85..135 CDD:438954
WD40 210..488 CDD:238121 79/286 (28%)
WD40 repeat 213..248 CDD:293791 12/34 (35%)
WD40 repeat 254..288 CDD:293791 10/36 (28%)
WD40 repeat 293..330 CDD:293791 15/38 (39%)
WD40 repeat 337..370 CDD:293791 11/80 (14%)
WD40 repeat 376..410 CDD:293791 11/35 (31%)
WD40 repeat 416..459 CDD:293791 4/24 (17%)
WD40 repeat 465..487 CDD:293791
CG7568NP_001263071.1 WD40 117..467 CDD:441893 81/289 (28%)
WD40 repeat 122..158 CDD:293791
WD40 repeat 189..222 CDD:293791 12/33 (36%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 15/38 (39%)
WD40 repeat 314..348 CDD:293791 8/33 (24%)
WD40 repeat 355..393 CDD:293791 3/37 (8%)
WD40 repeat 400..436 CDD:293791 11/35 (31%)
WD40 repeat 442..466 CDD:293791 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.