DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and daw1

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_989349.1 Gene:daw1 / 394975 XenbaseID:XB-GENE-5802528 Length:415 Species:Xenopus tropicalis


Alignment Length:423 Identity:113/423 - (26%)
Similarity:191/423 - (45%) Gaps:61/423 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGLA 151
            |.:.|.|...:|.:.|.|        .|:..|:      ..|.....|:||.|      |...:.
 Frog    31 DLLELSPTTDVDLVVEEI--------QKAEPLI------TASRTQQVKQLILR------LQEKIG 75

  Fly   152 ERRNWMQYLFKPRPGQTQRPH-------SFHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSEN 209
            ::.:...||||     ..|.|       :|::.....|....|.....|.|...  ..::....:
 Frog    76 QQDSRQFYLFK-----VLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASG--EELHTLEGH 133

  Fly   210 SKGVYCLQYDD---GKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDK--VIISGSSD 269
            ...||.:|:::   .||.:|..|.|.|:|.....:|..|..|||..::||.::.:  :|.:||.|
 Frog   134 RNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMD 198

  Fly   270 STVRVWDVNTGEMVNTLIHHCEAVLHLRFN--NGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGH 332
            :|.::||:.:||...||..|...::.|.||  ...::|.|.|.:::||::.|...|   ..|:||
 Frog   199 TTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRI---HTLIGH 260

  Fly   333 RAAVNVVDF--DEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACLQY--RDRLVVSGSSDN 393
            |..::...|  |...|.:||.|::.|:|.:.:.:.|.||.||:..:..:.:  ..:||.:.|:|.
 Frog   261 RGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADG 325

  Fly   394 SIRLWDIECGACLRVLEGHEELVRCIRFDTK--RIVSGAYDGKIKVWDLVAALDPRAASNTLCLN 456
            :.|::......||..|||||..:..|.|:.:  ||::.:.|...::|      :|....   ||.
 Frog   326 TARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLW------NPHTGE---CLQ 381

  Fly   457 TLVEHTGRVFRLQF--DEFQIVSSSHDDTILIW 487
            .|..||..:|...|  :...|::.|.|:|..||
 Frog   382 VLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940
F-box-like 89..136 CDD:289689 9/46 (20%)
WD40 <192..495 CDD:225201 90/311 (29%)
WD40 210..488 CDD:238121 88/293 (30%)
WD40 repeat 213..248 CDD:293791 12/37 (32%)
WD40 repeat 254..288 CDD:293791 13/35 (37%)
WD40 repeat 293..330 CDD:293791 10/38 (26%)
WD40 repeat 337..370 CDD:293791 10/34 (29%)
WD40 repeat 376..410 CDD:293791 7/35 (20%)
WD40 repeat 416..459 CDD:293791 9/44 (20%)
WD40 repeat 465..487 CDD:293791 6/23 (26%)
daw1NP_989349.1 CEP19 4..>81 CDD:317357 14/69 (20%)
WD40 84..373 CDD:238121 84/304 (28%)
WD 1 90..129 6/40 (15%)
WD40 repeat 96..132 CDD:293791 5/37 (14%)
WD 2 132..174 12/41 (29%)
WD40 repeat 137..175 CDD:293791 12/37 (32%)
WD 3 175..214 14/38 (37%)
WD40 repeat 181..217 CDD:293791 13/35 (37%)
WD 4 217..256 11/41 (27%)
WD40 repeat 222..258 CDD:293791 10/38 (26%)
WD 5 259..298 12/38 (32%)
WD40 repeat 265..300 CDD:293791 10/34 (29%)
WD 6 301..340 9/38 (24%)
WD40 repeat 306..342 CDD:293791 7/35 (20%)
WD 7 343..384 12/49 (24%)
WD40 repeat 348..384 CDD:293791 9/44 (20%)
WD40 376..414 CDD:197651 11/40 (28%)
WD 8 386..415 10/29 (34%)
WD40 repeat 390..414 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.