DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and wmd

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001097436.1 Gene:wmd / 37727 FlyBaseID:FBgn0034876 Length:328 Species:Drosophila melanogaster


Alignment Length:321 Identity:74/321 - (23%)
Similarity:139/321 - (43%) Gaps:41/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LRRI--NCRSENSKGVYCLQYDD----GK-IVSGLRDNT--IKIWDRTDLQCVKTLMGHTGSV-- 253
            ||:|  .| |.:::.|..|.:.|    |. ::|..:|.:  ::..|..|  .|.|..||.|:|  
  Fly     6 LRQIPLTC-SGHTRPVVHLDFSDICDAGYFLISACKDGSPMLRHGDTGD--WVGTFEGHKGAVWN 67

  Fly   254 LCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGM--MVTCSKDRSIAVWD 316
            ..|..:..:..||::|.|.:||:..||..::: ..|...|..:.|:...  :||.|.::.:.|::
  Fly    68 ATLNRNATLAASGAADFTGKVWNAVTGAEIHS-FQHKHIVKSVAFDRDSENIVTGSNEKLVRVFN 131

  Fly   317 MTSPSEITLRRVLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWSTSSCEFVRTLNGHKRGIACL 379
            :..|.  .......||..|:....|  .:|.|:||:.|:|:::|...:...|:.|..:....:..
  Fly   132 LEQPE--AQPEEYAGHTGAIKRALFCRGDKCIISAAEDKTVRLWDRMTGIEVQRLQFNSNPNSLE 194

  Fly   380 QYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTKRI-VSGAYDGKIKVWDLVAA 443
            ...|..:::.|..:||..|:|:....|:.::....:........|.: |.|..|.|:..:|.:..
  Fly   195 ISSDNHILTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDKHVFVCGGEDFKMYKFDYITG 259

  Fly   444 LDPRAASNTLCLNTLVEHTGRVFRLQF--DEFQIVSSSHDDTILIWDFLNFTPNENKTGRT 502
            .:         :.:...|.|.|..::|  |.....|.|.|.|:.:|        :...|:|
  Fly   260 NE---------IESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLW--------QTTVGKT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940
F-box-like 89..136 CDD:289689
WD40 <192..495 CDD:225201 72/312 (23%)
WD40 210..488 CDD:238121 66/293 (23%)
WD40 repeat 213..248 CDD:293791 10/41 (24%)
WD40 repeat 254..288 CDD:293791 9/33 (27%)
WD40 repeat 293..330 CDD:293791 7/38 (18%)
WD40 repeat 337..370 CDD:293791 9/34 (26%)
WD40 repeat 376..410 CDD:293791 7/33 (21%)
WD40 repeat 416..459 CDD:293791 6/43 (14%)
WD40 repeat 465..487 CDD:293791 7/23 (30%)
wmdNP_001097436.1 WD40 12..297 CDD:238121 69/307 (22%)
WD40 repeat 25..60 CDD:293791 8/36 (22%)
WD40 repeat 66..101 CDD:293791 9/35 (26%)
WD40 repeat 108..144 CDD:293791 6/37 (16%)
WD40 repeat 150..186 CDD:293791 10/35 (29%)
WD40 repeat 190..225 CDD:293791 7/34 (21%)
WD40 repeat 231..266 CDD:293791 6/43 (14%)
WD40 repeat 272..308 CDD:293791 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44156
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.