DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and CG10459

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_610513.2 Gene:CG10459 / 36000 FlyBaseID:FBgn0033440 Length:322 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:121/315 - (38%) Gaps:82/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SIENNWRTGRHMLRRINCRSENSKGVYCLQY-DDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTG 251
            |...::.||..:      .|....||..|:: |.|..::.||.:|..:|.               
  Fly    20 SFNRDYDTGYFL------ASAGLDGVAALRHGDTGDCITHLRKHTDSVWS--------------- 63

  Fly   252 SVLCLQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFN---NGMMVTC-SKDRSI 312
              :.|.:|.|::.||.:|..|||||...|:.:..| .|.:.|..:..|   ..::..| .::..:
  Fly    64 --VSLSHDAKILASGGADCKVRVWDALLGKQLKKL-RHTKTVACVDLNPKATRLLTGCIDQESPL 125

  Fly   313 AVWDMTSPSEITLRRVLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWS------TSSC---EFV 366
            |::||....:..|.. ..||...|..|.|  :|...:|:|.|||:::|.      |:|.   ..|
  Fly   126 ALFDMEQSEKAPLME-FRGHSRGVRDVIFCLEEHCFLSSSYDRTVRMWDCRTGTRTNSIFLPHHV 189

  Fly   367 RTLNGHKRG-IACLQYRDRLV---------------------VSGSSDNSIRL------------ 397
            ::|..|..| |..:.|...::                     .|.|.:..|.:            
  Fly   190 KSLELHHSGDIVTIAYAGGVIFLDPKSFEVLKHRKLPYKVTAASLSPNKGIYVCGNNMGYSFKYD 254

  Fly   398 WDIECGACLRVLEGHEELVRCIRF--DTKRIVSGAYDGKIKVWDLVAALDPRAAS 450
            :|.:....|.|.: ....|..:.|  |.:....|:.||.|.:|.    ::|:.||
  Fly   255 YDTDVDRGLYVSQ-EPSAVLALSFSPDGEVCAIGSQDGSIILWQ----MNPKQAS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940
F-box-like 89..136 CDD:289689
WD40 <192..495 CDD:225201 70/311 (23%)
WD40 210..488 CDD:238121 67/293 (23%)
WD40 repeat 213..248 CDD:293791 8/35 (23%)
WD40 repeat 254..288 CDD:293791 13/33 (39%)
WD40 repeat 293..330 CDD:293791 7/40 (18%)
WD40 repeat 337..370 CDD:293791 12/43 (28%)
WD40 repeat 376..410 CDD:293791 8/66 (12%)
WD40 repeat 416..459 CDD:293791 11/37 (30%)
WD40 repeat 465..487 CDD:293791
CG10459NP_610513.2 WD40 <10..322 CDD:225201 71/315 (23%)
WD40 11..297 CDD:295369 67/302 (22%)
WD40 repeat 61..97 CDD:293791 14/53 (26%)
WD40 repeat 103..143 CDD:293791 6/40 (15%)
WD40 repeat 148..185 CDD:293791 12/36 (33%)
WD40 repeat 190..222 CDD:293791 5/31 (16%)
WD40 repeat 229..264 CDD:293791 4/34 (12%)
WD40 repeat 272..298 CDD:293791 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44156
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.