DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and DAW1

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_849143.1 Gene:DAW1 / 164781 HGNCID:26383 Length:415 Species:Homo sapiens


Alignment Length:449 Identity:118/449 - (26%)
Similarity:198/449 - (44%) Gaps:79/449 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MCHYQ-HGQINAYLKPMLQRDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGM 131
            |..|: ||::..  |.:   |.:.|.|...:..:.|.|..   ||.|.::           |...
Human    16 MLEYEKHGELKT--KSI---DLLDLGPSTDVSALVEEIQK---AEPLLTA-----------SRTE 61

  Fly   132 LWKKLIERKVRTDSLWRGLAERRNWMQYLFKPRPGQTQRPHSFHRELFPK------------IMN 184
            ..|.||:|      |...|.:..|...||||     ..:.|     :.|.            |..
Human    62 QVKLLIQR------LQEKLGQNSNHTFYLFK-----VLKAH-----ILPLTNVALNKSGSCFITG 110

  Fly   185 DIDSIENNWRTGRHMLRRINCRSENSKGVYCLQYDD---GKIVSGLRDNTIKIWDRTDLQCVKTL 246
            ..|.....|.|...  ..:|....:...||.:.:::   .||.:|..|.|.|:|.....:|..|.
Human   111 SYDRTCKLWDTASG--EELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTF 173

  Fly   247 MGHTGSVLCLQYDDK--VIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNG--MMVTCS 307
            .|||..::||.::.:  ::.:||.|:|.::||:..||.|.||..|...::.|.||..  .::|.|
Human   174 RGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGS 238

  Fly   308 KDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDF--DEKYIVSASGDRTIKVWSTSSCEFVRTLN 370
            .|.::.|||..:..::   .:|:||.|.::...|  |...|::.|.|:|.|:|..::.:.|.||.
Human   239 FDHTVVVWDADTGRKV---NILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLT 300

  Fly   371 GHKRGI--ACLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEELVRCIRFDTK--RIVSGAY 431
            ||...|  :|..|..:|:.:.|:|.:.|::......|:..|||||..:..|.|:.:  .:::|:.
Human   301 GHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSS 365

  Fly   432 DGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQFDEFQ---IVSSSHDDTILIW 487
            |...::||         |....||..|..||..:|...|: ::   :::.|.|:|..||
Human   366 DKTARIWD---------AQTGQCLQVLEGHTDEIFSCAFN-YKGNIVITGSKDNTCRIW 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940 5/17 (29%)
F-box-like 89..136 CDD:289689 9/46 (20%)
WD40 <192..495 CDD:225201 89/312 (29%)
WD40 210..488 CDD:238121 86/294 (29%)
WD40 repeat 213..248 CDD:293791 11/37 (30%)
WD40 repeat 254..288 CDD:293791 13/35 (37%)
WD40 repeat 293..330 CDD:293791 9/38 (24%)
WD40 repeat 337..370 CDD:293791 10/34 (29%)
WD40 repeat 376..410 CDD:293791 8/35 (23%)
WD40 repeat 416..459 CDD:293791 9/44 (20%)
WD40 repeat 465..487 CDD:293791 5/24 (21%)
DAW1NP_849143.1 eRF1 <22..>90 CDD:224420 23/97 (24%)
WD40 81..120 CDD:197651 8/48 (17%)
WD 1 90..129 6/45 (13%)
WD40 repeat 96..132 CDD:293791 5/37 (14%)
WD40 126..415 CDD:238121 87/302 (29%)
WD 2 132..174 11/41 (27%)
WD40 repeat 137..175 CDD:293791 11/37 (30%)
WD 3 175..214 14/38 (37%)
WD40 repeat 181..217 CDD:293791 13/35 (37%)
WD 4 217..256 10/41 (24%)
WD40 repeat 222..258 CDD:293791 9/38 (24%)
WD 5 259..298 12/38 (32%)
WD40 repeat 265..300 CDD:293791 10/34 (29%)
WD 6 301..340 10/38 (26%)
WD40 repeat 306..342 CDD:293791 8/35 (23%)
WD 7 343..384 12/49 (24%)
WD40 repeat 348..384 CDD:293791 9/44 (20%)
WD 8 386..415 9/30 (30%)
WD40 repeat 390..414 CDD:293791 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.