DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slmb and LOC101734139

DIOPT Version :9

Sequence 1:NP_001262802.1 Gene:slmb / 42504 FlyBaseID:FBgn0283468 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_012817528.2 Gene:LOC101734139 / 101734139 -ID:- Length:452 Species:Xenopus tropicalis


Alignment Length:473 Identity:106/473 - (22%)
Similarity:181/473 - (38%) Gaps:131/473 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RDFITLLPIKGLDHIAENILSYLDAESLKSSELVCKEWLRVISEGMLWKKLIERKVRTDSLWRGL 150
            :|..:.||    |.:|..|||||||:.:......|:.|..:..:..||    :.|.:.|    |:
 Frog    15 QDCTSWLP----DELALRILSYLDAKDILQVAQTCQRWRELAEDEGLW----QGKCKAD----GI 67

  Fly   151 AERRNWMQYLFKPRPGQTQRP--HSFHRELFPKIMNDIDSIENNWRTGRHMLRRINCRSE----- 208
            .|..:     .....|...||  .::..:|         .::.|||.||.....::...:     
 Frog    68 EEPLH-----ISTATGSRPRPWKSAYTNQL---------RVDTNWRRGRFKTITVDLFGDYRNPD 118

  Fly   209 ----NSKGVYCLQYDDGKIVSGLRDNTIKIWDRTDLQCVKTLMGHTGSVLCLQYDDKVIISGSSD 269
                |.|.:.|..:.:          .||:|.....:|.:||:||..||..:|..|.:|::|..|
 Frog   119 HVGFNGKELVCTTHKE----------IIKVWSAVTGECPRTLVGHRASVTAVQMRDHMIVTGYLD 173

  Fly   270 STVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRA 334
            .|:.||:..:|..::||..|...:.::..:.....:||.||:|.|||:.:...:   ..|:||:.
 Frog   174 GTINVWNAESGACIHTLGGHTSHIHNVHLHEQRAASCSSDRTIRVWDIEAGQCL---HTLLGHKL 235

  Fly   335 AVNVV-----------------------------------------DFDEKYIVS-ASGDRTIKV 357
            ||..|                                         .||.|:||| ...:.||.|
 Frog   236 AVTWVWYNGRRLLSEDLSHIVRTWDPETETCLRSVSLRCGTYLRFAHFDGKHIVSLLCPEETIAV 300

  Fly   358 WSTSSCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNSIRLWDIECGACLRVL---EGHEELVRCI 419
            |...:.|..||:.|....:..|  ::.::...:|.::..:|::|.|..|.||   :|.:.....:
 Frog   301 WDGETLEHTRTIPGTYTAVMTL--KNSILGVVNSGHAAEIWNVETGQRLNVLQDPDGFDHYAYDL 363

  Fly   420 RFDTKRIVSGAYDGKIKVWDLVAALDPRAASNTLCLNTLVEHTGRVFRLQF---------DEFQI 475
            ......::.....|:|.:||.                    .||:..|..|         .:|..
 Frog   364 GLQGDFLIGRTGTGRITLWDW--------------------RTGKFLRNLFVPKREEDCDPDFHT 408

  Fly   476 VSSSHDDTILIWDFLNFT 493
            .|:.|     |:.|:|:|
 Frog   409 FSTKH-----IYVFVNWT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slmbNP_001262802.1 Beta-TrCP_D 47..85 CDD:288940
F-box-like 89..136 CDD:289689 15/46 (33%)
WD40 <192..495 CDD:225201 82/365 (22%)
WD40 210..488 CDD:238121 73/331 (22%)
WD40 repeat 213..248 CDD:293791 7/34 (21%)
WD40 repeat 254..288 CDD:293791 11/33 (33%)
WD40 repeat 293..330 CDD:293791 8/36 (22%)
WD40 repeat 337..370 CDD:293791 14/74 (19%)
WD40 repeat 376..410 CDD:293791 8/36 (22%)
WD40 repeat 416..459 CDD:293791 4/42 (10%)
WD40 repeat 465..487 CDD:293791 5/30 (17%)
LOC101734139XP_012817528.2 F-box-like 21..62 CDD:403981 15/48 (31%)
WD40 <136..322 CDD:421866 50/188 (27%)
WD40 repeat 158..191 CDD:293791 10/32 (31%)
WD40 repeat 197..231 CDD:293791 8/36 (22%)
WD40 repeat 276..313 CDD:293791 13/36 (36%)
WD40 repeat 338..394 CDD:293791 14/75 (19%)
WD40 repeat 402..428 CDD:293791 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.