DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bdbt and Ttc9b

DIOPT Version :10

Sequence 1:NP_650943.1 Gene:Bdbt / 42503 FlyBaseID:FBgn0038857 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_082693.1 Gene:Ttc9b / 73032 MGIID:1920282 Length:239 Species:Mus musculus


Alignment Length:61 Identity:21/61 - (34%)
Similarity:35/61 - (57%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VEELFIQIQTNLAACLLQEK--RYEHVIYHTQFVETEESPSEKSIYRRALAYYHLKEFAKA 243
            ||...::...:|.|||||.:  .||.|..:...|..::..:.|:.||..:|:|||.::|:|
Mouse   128 VENTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BdbtNP_650943.1 FKBP_N_2 9..117 CDD:375495
Ttc9bNP_082693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
TPR 1 63..97
TPR repeat 63..91 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..121
TPR repeat 133..163 CDD:276809 10/29 (34%)
PEP_TPR_lipo <150..>218 CDD:274350 13/39 (33%)
TPR repeat 168..198 CDD:276809 9/21 (43%)
TPR 2 169..202 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.