DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bdbt and TTC9B

DIOPT Version :10

Sequence 1:NP_650943.1 Gene:Bdbt / 42503 FlyBaseID:FBgn0038857 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_016881857.1 Gene:TTC9B / 148014 HGNCID:26395 Length:280 Species:Homo sapiens


Alignment Length:103 Identity:29/103 - (28%)
Similarity:50/103 - (48%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VEELFIQIQTNLAACLLQEK--RYEHVIYHTQFVETEESPSEKSIYRRALAYYHLKEFAKA---- 243
            ||...::...:|.|||||.:  .||.|..:...|..::..:.|:.||..:|:|||.::|:|    
Human   130 VESTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYL 194

  Fly   244 QATIERMPNYEEKREFS-----KLRDNIAVSWKDSKAH 276
            |....|.|....:.:.|     ::|   :|:...:|.|
Human   195 QEARSREPTVARREQTSCRCRWRMR---SVTGASAKRH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BdbtNP_650943.1 FKBP_N_2 9..117 CDD:375495
TTC9BXP_016881857.1 TPR repeat 65..93 CDD:276809
TPR repeat 134..166 CDD:276809 10/31 (32%)
TPR 145..>206 CDD:440225 19/60 (32%)
TPR repeat 171..197 CDD:276809 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.