DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppan and SSF1

DIOPT Version :9

Sequence 1:NP_476979.1 Gene:ppan / 42502 FlyBaseID:FBgn0010770 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_011933.1 Gene:SSF1 / 856463 SGDID:S000001108 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:147/453 - (32%)
Similarity:229/453 - (50%) Gaps:89/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKKVHPKTRTAAFKASEPSEIVEAPHSFVIHRG---LACPYITDLTLDFRRIMEPFTASNLREKR 65
            ||:.|.:.        .|.:....|.|.||..|   ||...:..|..|||:||:|.||..|:|::
Yeast     7 KKRTHAQL--------TPEQEQGIPKSMVIRVGQTSLANHSLNQLVKDFRQIMQPHTAIKLKERK 63

  Fly    66 MNRIKDFVSLSSFFHVSHMGIFNKA--STQLSFKVVRLPRGPSLTFKVHQFTLARDVIS-LSKKQ 127
            .|::||||.:.....|:|:.:|.::  :..:|.|:.|.|:||::||:|..::|.||:.. |.:.:
Yeast    64 SNKLKDFVVMCGPLGVTHLFMFTQSEKTGNVSLKIARTPQGPTVTFQVLDYSLGRDIKKFLKRPK 128

  Fly   128 MIDNDHFKHAPLVIMNNFS---------GDGKHLKLMATTFQNMFPSINLATVNIGTIRRCVLFS 183
            .::||...:.||:::|.||         .|....|::.:.|||:||.:|.|..::.:|:|..:.:
Yeast   129 SLNNDDVLNPPLLVLNGFSTSKRSGEDDQDVNVEKVIVSMFQNIFPPLNPARTSLNSIKRVFMIN 193

  Fly   184 YNPDTKLVEMRHYSVQVVPVGLKRAVQKIVKG------TVPNLGKCNEVVDFVTK---DGYASES 239
            .:.:|..:.||||.:.:..|.:.|.::::.|.      |||||.:..::...:..   ..|.|||
Yeast   194 KDRETGEISMRHYFIDIREVEISRNLKRLYKAKNNLSKTVPNLHRKEDISSLILDHDLGAYTSES 258

  Fly   240 EAEDDEQSHVV--------LAQTLKS-------KGNLE------------------------DKK 265
            |.|||....||        .:|:|||       |.|.|                        .:|
Yeast   259 EIEDDAIVRVVDNQDVKAKHSQSLKSQRTPVEKKDNKEREKETEEEDVEMEEPKPSENLQPTPRK 323

  Fly   266 SSIKLHEIGPRLTMQLIKIEEGLLTGEVLYHDHVVKTEDEKETLRKLVEKKRKQKEQRKKEQAEN 330
            .:|||.|:|||||::|:|||||:.:|:||:|:.|.|:.:|.:.|.|....|.:.||||||||.||
Yeast   324 KAIKLTELGPRLTLKLVKIEEGICSGKVLHHEFVQKSSEEIKALEKRHAAKMRLKEQRKKEQEEN 388

  Fly   331 RARNLKLKKDEKWAAK------RAAEG----------RTDSDPEDDAEYYKEEVGEEPDEELF 377
            .|:. |..||.|...|      |||||          ..|.....|:|:| ..|.|:.|.:||
Yeast   389 IAKK-KAVKDAKKQRKLERRKARAAEGGEGQGKDDAMSDDESSSSDSEHY-GSVPEDLDSDLF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppanNP_476979.1 Brix 31..212 CDD:214879 62/195 (32%)
Brix <215..295 CDD:294606 40/127 (31%)
SSF1NP_011933.1 Brix 26..220 CDD:214879 62/193 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341477
Domainoid 1 1.000 137 1.000 Domainoid score I1065
eggNOG 1 0.900 - - E1_KOG2963
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5690
Inparanoid 1 1.050 197 1.000 Inparanoid score I873
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53510
OrthoFinder 1 1.000 - - FOG0004323
OrthoInspector 1 1.000 - - otm46665
orthoMCL 1 0.900 - - OOG6_101976
Panther 1 1.100 - - O PTHR12661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1766
SonicParanoid 1 1.000 - - X3054
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.