DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppan and PPAN-P2RY11

DIOPT Version :9

Sequence 1:NP_476979.1 Gene:ppan / 42502 FlyBaseID:FBgn0010770 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001035754.1 Gene:PPAN-P2RY11 / 692312 HGNCID:33526 Length:794 Species:Homo sapiens


Alignment Length:436 Identity:169/436 - (38%)
Similarity:260/436 - (59%) Gaps:33/436 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MG--GKKKVHPKTRTAAFKASEPSEIVEAPHSFVIHRGLACPYITDLTLDFRRIMEPFTASNLRE 63
            ||  |:.: |.|...|..:..........|||||..||.....|..|:||.||:|||.|||.|:.
Human     1 MGQSGRSR-HQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQV 64

  Fly    64 KRMNRIKDFVSLSSFFHVSHMGIFNKASTQLSFKVVRLPRGPSLTFKVHQFTLARDVISLSKKQM 128
            ::.|.:||.|:::....|:|..|.:|..|.:.||::|||.||:|||:|.:::|.|||:|..::..
Human    65 RKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHR 129

  Fly   129 IDNDHFKHAPLVIMNNFSGDGKHLKLMATTFQNMFPSINLATVNIGTIRRCVLFSYNPDTKLVEM 193
            :....|.|.||:::|:|...|.|:|||||.|||:|||||:..||:.||:||:|..||||::.::.
Human   130 MHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDF 194

  Fly   194 RHYSVQVVPVGLKRAVQKIVKGTVPNLGKCNEVVDFVTKDGYASESEAEDDEQSHVV-LAQTLKS 257
            ||||::|||||..|.::|:::...||:.:..::.:.:......||||||.|...::. |.|.:..
Human   195 RHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAG 259

  Fly   258 KGNLEDKKSSIKLHEIGPRLTMQLIKIEEGLLTGEVLYHDHVVKTEDEKETLRKLVEKKRKQKEQ 322
            :||:..::|:::|.|||||:|:||||::||:..|:|::|..|.|||:|.:.:.:..|||.:.|.|
Human   260 RGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQ 324

  Fly   323 RKKEQAEN-----------RARNLK-LKKDEKWAAKRAAEG---RT---------DSDPEDDAEY 363
            |:.:||:|           |.::|: :||.....:...|.|   ||         |...:||.||
Human   325 RQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEY 389

  Fly   364 YKEEVGEEPDEELFKMEAKSSRKRPSLGGGMKYKNKRAKLDTKDKN 409
            :.:.|||.|.|:||. |||..|...|.|    .|.||.::|...|:
Human   390 FCQAVGEAPSEDLFP-EAKQKRLAKSPG----RKRKRWEMDRGAKS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppanNP_476979.1 Brix 31..212 CDD:214879 84/180 (47%)
Brix <215..295 CDD:294606 29/80 (36%)
PPAN-P2RY11NP_001035754.1 Brix 36..285 CDD:282306 106/248 (43%)
Brix <270..341 CDD:294606 30/70 (43%)
7tm_1 466..741 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141372
Domainoid 1 1.000 227 1.000 Domainoid score I2512
eggNOG 1 0.900 - - E1_KOG2963
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 298 1.000 Inparanoid score I2729
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53510
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004323
OrthoInspector 1 1.000 - - oto89153
orthoMCL 1 0.900 - - OOG6_101976
Panther 1 1.100 - - LDO PTHR12661
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1766
SonicParanoid 1 1.000 - - X3054
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.