DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and Rab14

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_446041.2 Gene:Rab14 / 94197 RGDID:620881 Length:215 Species:Rattus norvegicus


Alignment Length:167 Identity:92/167 - (55%)
Similarity:116/167 - (69%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQER 72
            |.|:||.::|||.|||||.||.:||..:|..:...||||||.||.|||.|:.||.||||||||||
  Rat     8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQER 72

  Fly    73 YRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTD 137
            :||:|.:|||||.|||:||||.:..||.::..||.:.|:..:.|.||:|:|||:||...|.|..:
  Rat    73 FRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYE 137

  Fly   138 EAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYR 174
            |||.|||.|||.|:|.||....|||.||.....:||:
  Rat   138 EAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 89/163 (55%)
Rab14NP_446041.2 Rab14 10..175 CDD:133322 91/165 (55%)
Effector region. /evidence=ECO:0000250 40..48 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.