DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RAB18

DIOPT Version :10

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_175056.1 Gene:RAB18 / 840987 AraportID:AT1G43890 Length:212 Species:Arabidopsis thaliana


Alignment Length:176 Identity:80/176 - (45%)
Similarity:115/176 - (65%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAR--EDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQ 63
            ||:.  :.|:||||||:||||||||||:||..||.|.|: :...||||:|..:.:.:..|.:|..
plant     1 MGSSSGQPEFDYLFKVLLIGDSGVGKSSLLLSFTSNTFD-DLSPTIGVDFKVKYLTIGEKKLKLA 64

  Fly    64 IWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV-ERWLRELRDHA-DQNIVIMLVGNKS 126
            |||||||||:|.:||:|||||.|.::|||:.:..|:.|: :.|.:|:..:: :|:.:.||||||.
plant    65 IWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEIDLYSTNQDCIKMLVGNKV 129

  Fly   127 DLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEI 172
            |....|:|...|...||...|..|:|.||....|||..|:.::.:|
plant   130 DKESERAVSKKEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 77/166 (46%)
RAB18NP_175056.1 PLN03118 1..200 CDD:215587 80/176 (45%)

Return to query results.
Submit another query.