DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab11 and RABA3

DIOPT Version :9

Sequence 1:NP_477170.1 Gene:Rab11 / 42501 FlyBaseID:FBgn0015790 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_171628.2 Gene:RABA3 / 839493 AraportID:AT1G01200 Length:237 Species:Arabidopsis thaliana


Alignment Length:208 Identity:117/208 - (56%)
Similarity:150/208 - (72%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQ 70
            ::.||:||||:||||.|||:.||||||.|||..:|||||||||.||:|.:.||.:||||||||||
plant    23 EKIDYVFKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTAGQ 87

  Fly    71 ERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR-HLRSV 134
            |||||:||||||||:||::||||.|.|::::|.||:.|||.|||.:.||||||||:||. ..|:|
plant    88 ERYRAVTSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLSVGKRAV 152

  Fly   135 PTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYR--IVSQKQIR---------DPPEGD 188
            ||::|..|||...|.|.|.|||...||:.||..:|.||:.  :||:|.:.         |....|
plant   153 PTEDAVEFAETQRLFFSEVSALSGGNVDEAFFRLLEEIFSRVVVSRKAMESDGGATVKLDGSRID 217

  Fly   189 VIRPSNVEPIDVK 201
            ||..|::|..::|
plant   218 VISGSDLETSNIK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab11NP_477170.1 Rab11_like 9..173 CDD:206660 106/164 (65%)
RABA3NP_171628.2 Rab11_like 26..191 CDD:206660 106/164 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133775at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.